SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036774 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036774
Domain Number 1 Region: 326-606
Classification Level Classification E-value
Superfamily Folate-binding domain 5.18e-78
Family Aminomethyltransferase folate-binding domain 0.0000399
Further Details:      
 
Domain Number 2 Region: 12-115,226-290
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.51e-32
Family FAD-linked reductases, N-terminal domain 0.0029
Further Details:      
 
Domain Number 3 Region: 115-225
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.24e-30
Family L-aminoacid/polyamine oxidase 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036774   Gene: ENSCJAG00000019768   Transcript: ENSCJAT00000038837
Sequence length 624
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:129194265:129251239:1 gene:ENSCJAG00000019768 transcript:ENSCJAT00000038837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRTGWHATEQCIIEPEKIQEMFPLLNMNKVLAGLYNPGDGHIDPYSLTMALAAGARKYG
ALLKYPAPVTSLKPRSDGTWDVETPQGSMRANRIVNAAGFWAREVGKIIGLEHPLIPVQH
QYVVTSTIPEVKALKRELPVLRDLEGSYYLRQERDGLLFGPYESQEKMKVQDSWVTNGVP
PGFGKELFESDLDRIMEYIEIAMEMVPVLKNADIINVVNGPITYSPDILPMVGPHQGVRN
YWVAIGFGYGIIHAGGVGKYLSDWILHGEPPFDLIELDPNRYGKWTTTQYTEAKARESYG
FNNIVGYPKEERFAGRPTQRVSGLYRSLESKCSMGFHAGWEQPHWFYKPGQDTQYRPSFR
RTNWFEPVGSEYKQVMQRVGVIDLTPFGKFNIKGRDSIRLLDRLFANIIPKVGFTNISHM
LTPKGRVYAELTVSHQCPGEFLLITGSGSELHDLRWIEEEAVKGGYDVEIKNITDEFGVL
GVAGPRARKILQKLTSEDLSEDVFKFLQTKSLKISNIPVTAIRISYTGELGWELYHRRED
SVALYDMIMNAGQEEGIDNFGTYAMNALRLEKAFRAWGSEMNCDTNPLEAGLEYFVKLNK
DKNSCFAHFKEENGWVSRWAIRPY
Download sequence
Identical sequences F6QJR5
ENSCJAP00000036774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]