SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037016 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037016
Domain Number 1 Region: 50-74
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000267
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000037016
Domain Number - Region: 106-128
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0314
Family CCCH zinc finger 0.0094
Further Details:      
 
Domain Number - Region: 132-158
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0455
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037016   Gene: ENSCJAG00000019911   Transcript: ENSCJAT00000039094
Sequence length 165
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:122433699:122447122:-1 gene:ENSCJAG00000019911 transcript:ENSCJAT00000039094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFETDVETQKGTGLLPFQGMDNEACPSCCLGPSALASPGKFCPFWHDRGEKTVVCKHWLR
GLCKKGDPCKFLHQCDLTRRPECCFYSTFGDCSSKRPFLHVKPALKNRDCPWYDQGFYKD
GPLCKYHHVPRIMCLNYLVGFCPKEPKCQFVQKTWELKLLPGSKI
Download sequence
Identical sequences F6ZK54
ENSCJAP00000037016 ENSCJAP00000037016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]