SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037081 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037081
Domain Number 1 Region: 489-819
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.14e-106
Family PDEase 0.00000128
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000037081
Domain Number - Region: 142-214
Classification Level Classification E-value
Superfamily CheY-like 0.00133
Family CheY-related 0.015
Further Details:      
 
Domain Number - Region: 285-322
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00565
Family Flavin-binding PAS domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037081   Gene: ENSCJAG00000019876   Transcript: ENSCJAT00000039160
Sequence length 831
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:130938477:131156692:-1 gene:ENSCJAG00000019876 transcript:ENSCJAT00000039160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVSQSGVIYCRDSDESNFSHQTTSVSQGPAAPLPGLFVQTDAADAIPPSRASGPPSAARV
RRARAELGSGSSAGSAAPAATTSRGRRRHCCSSAEAETQTSYTSVKQVSSAEVRIGPMRL
TQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRQT
QNFDAEAVCRSIRATNPSEHTVILAVVSRVSDDHEEASVLPLLHAGFNRRFMENSSIIAC
YNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQEWQGVYYARRKSGDS
IQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRR
KESIDVKSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEA
LDRVLEILRTTELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHL
AMPITINDVPPCISQLLDNEESWDFNIFELEAVTHKRPLVYLGLKVFTRFGVCEFLNCSE
TTLRAWFQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATV
HDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYR
TLRQAIIDMVLATEMTKHFEHVNKFVNSINKPMAAEIEGSDCECNPAGKNFPENQILIKR
MMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQI
SFIDYFITDMFDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDS
Download sequence
Identical sequences F6X9M7
ENSCJAP00000037081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]