SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037093 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037093
Domain Number 1 Region: 536-866
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.37e-106
Family PDEase 0.00000128
Further Details:      
 
Domain Number 2 Region: 268-369
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.19e-17
Family Flavin-binding PAS domain 0.05
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000037093
Domain Number - Region: 142-214
Classification Level Classification E-value
Superfamily CheY-like 0.00145
Family CheY-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037093   Gene: ENSCJAG00000019876   Transcript: ENSCJAT00000039172
Sequence length 878
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:130938477:131156692:-1 gene:ENSCJAG00000019876 transcript:ENSCJAT00000039172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVSQSGVIYCRDSDESNFSHQTTSVSQGPAAPLPGLFVQTDAADAIPPSRASGPPSAARV
RRARAELGSGSSAGSAAPAATTSRGRRRHCCSSAEAETQTSYTSVKQVSSAEVRIGPMRL
TQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRQT
QNFDAEAVCRSIRATNPSEHTVILAVVSRVSDDHEEASVLPLLHAGFNRRFMENSSIIAC
YNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKG
ELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGDSIQQHVKITPVIGQ
GGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRG
SDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTEL
YSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHLAMPITINDVPPCI
SQLLDNEESWDFNIFELEAVTHKRPLVYLGLKVFTRFGVCEFLNCSETTLRAWFQVIEAN
YHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFL
CNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAIIDMVLAT
EMTKHFEHVNKFVNSINKPMAAEIEGSDCECNPAGKNFPENQILIKRMMIKCADVANPCR
PLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDA
WDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPSDS
Download sequence
Identical sequences F6WNM3
ENSCJAP00000037061 ENSCJAP00000037093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]