SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037101 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037101
Domain Number 1 Region: 1698-1944
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 654-786
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000889
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 320-444
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000149
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 807-938
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 516-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000116
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 6 Region: 469-595
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000675
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 199-369
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000001
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 1022-1139
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 9 Region: 14-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000754
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 52-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family EGF-type module 0.016
Further Details:      
 
Domain Number 11 Region: 89-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000214
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 12 Region: 129-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000292
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1382-1412
Classification Level Classification E-value
Superfamily Notch domain 0.0000000418
Family Notch domain 0.0034
Further Details:      
 
Domain Number 14 Region: 625-668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000005
Family EGF-type module 0.015
Further Details:      
 
Domain Number 15 Region: 1176-1215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000679
Family EGF-type module 0.014
Further Details:      
 
Domain Number 16 Region: 591-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000821
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 17 Region: 1295-1327
Classification Level Classification E-value
Superfamily Notch domain 0.0000000889
Family Notch domain 0.0015
Further Details:      
 
Domain Number 18 Region: 1135-1179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000108
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 19 Region: 935-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.02
Further Details:      
 
Domain Number 20 Region: 1247-1286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 21 Region: 988-1021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000947
Family EGF-type module 0.015
Further Details:      
 
Domain Number 22 Region: 167-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000036
Family EGF-type module 0.021
Further Details:      
 
Domain Number 23 Region: 442-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000073
Family EGF-type module 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000037101
Domain Number - Region: 788-816
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037101   Gene: ENSCJAG00000019931   Transcript: ENSCJAT00000039180
Sequence length 2206
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:371330:471691:-1 gene:ENSCJAG00000019931 transcript:ENSCJAT00000039180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGKLCQWTDACLSHPC
ANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIAGRCQHGGTCLNLPGSYQCQCPQGF
TGQYCDSPYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCEKNIDDCPNHKCQNGG
VCVDGVNTYNCRCPPQWTEGQFCTEDVDECLLQPNACQNGGTCANRNGGFGCVCVNGWSG
DDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDT
NPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTEGGFHCECLKGYAGPR
CEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDK
VNRFQCLCPPGFTGQVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATEGFTGVLCEENI
DNCDPDPCHHGQCQDGIDSYTCICSPGYMGTICSDQIDECYSNPCLNDGRCIDLVNGYQC
NCQPGTSGVNCEINFDDCTSNPCVHGICMDGINHYSCVCSPGFTGQRCNIDIDECASNPC
RKGATCVNGVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVG
INCEVDKNECLSNPCQNGGTCDDLVNGYRCTCPKGFKGKNCQTVLAPCSPNPCENAAVCK
ESPNFESYTCLCAPGWQGQQCTIDIDECISKPCMNHGLCHNTQGSYMCECPPGFSGMDCE
EDIDDCLANPCQNGGSCVDGVNTFSCICLPGFTEDKCQTDVNECLNEPCKNGGTCSDYVN
SYTCKCQAGFDGVHCENNIDECTESSCFNGGTCVDGVNSFSCLCPVGFTGPFCLHEINEC
SSHPCLNEGTCVDGLGTYHCTCSLGYTGKNCQTLVNLCSQSPCKNKGTCVQEKAESRCLC
PSGWAGAYCDVPNVSCDIAASSRGVPVEHLCQHSGVCINAGNTHYCQCPLGYTGSYCEEQ
LNECASNPCHHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHF
KCSCPPGSRGLLCEENIDDCAGGPHCLNGGQCVDRIGGYSCHCLPGFAGERCEGDINECL
SDPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFIDVCPQMPCLNGGTCAVASNMPDGF
ICRCPPGFSGARCQSSCGQVKCKKGEQCVHTASGPRCFCPNPQDCESGCASSPCQHGGSC
HPQRQPPFYSCQCTPPFWGSLCELYTVPPSTPPATCLSQYCADKARDGVCDEACNSHACQ
WDGGDCSLTMENPWANCSSPLPCWDYINNKWCFPLQAASHITCLQDGWKGDSGYKAEKAR
TRYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLLPPEQLLQDV
RSFLRALGTLLHTNLRIKQDSKGEPMVYPYYGEKSAAMKKQRMTRRSLPGEQEQEVAGSK
VFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVISESPAPERTQLLYLL
AVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSV
QVSEANLIGSGTSEHWVDDEGPQSKKVKAEDEALLSEEDNPIDRRPWTQQHLEAADIRRT
PSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDL
VYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADA
QGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALH
WAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHM
DRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMGKK
SRRPSAKSTMPTSLPNLAKEAKEAKGSRRKKSVSEKVQLSESSVTLSPVDSLESPHTYVS
DTTSSPLITSPGPLAHGASTVLPSVSQLLSHHHIVPPGSGSAGSLGRLHPVPVPADWMNR
MEVNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEAYHPFPASVGKYPTPPSQHSYASSNA
AERTPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSP
Download sequence
Identical sequences F6UY15
ENSCJAP00000037101 ENSCJAP00000037056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]