SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037106 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000037106
Domain Number - Region: 91-118
Classification Level Classification E-value
Superfamily Ribosomal protein S18 0.0112
Family Ribosomal protein S18 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037106   Gene: ENSCJAG00000019949   Transcript: ENSCJAT00000039185
Sequence length 121
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:31035099:31042443:1 gene:ENSCJAG00000019949 transcript:ENSCJAT00000039185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSVLNTLLRRLPMRSLFRGVHRVQVPLQTLCTKALSEEKSLPPVPISPYENEPWKYLE
SEEYQERYGSCPIWADYRRNHKGGVPPQRTRKTCIRGNKVAGNPCPICRDHKLHVDFRES
V
Download sequence
Identical sequences F6UXP8
ENSCJAP00000037106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]