SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037148 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037148
Domain Number 1 Region: 1656-1755
Classification Level Classification E-value
Superfamily Plakin repeat 4.19e-18
Family Plakin repeat 0.005
Further Details:      
 
Domain Number 2 Region: 268-393,581-610
Classification Level Classification E-value
Superfamily Spectrin repeat 6.06e-16
Family Spectrin repeat 0.0095
Further Details:      
 
Domain Number 3 Region: 691-804,834-861
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000316
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 4 Region: 141-212
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000157
Family Spectrin repeat 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000037148
Domain Number - Region: 570-705
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000144
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037148   Gene: ENSCJAG00000019959   Transcript: ENSCJAT00000039229
Sequence length 1756
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:4973845:5033346:-1 gene:ENSCJAG00000019959 transcript:ENSCJAT00000039229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSLFRKRNKGKYSPTVQTRSISNKELSELIEQLQKNADQVEKNIVDTEAKMQSDVARLQ
EGRQPEQRDMTLQKVLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVSNLRGK
HKQFYSLAVKEVDPQVNWAALVEEKLDKLSSQGFGTDLPLVDHQVEEHNIFHNEVKAIGP
HLAKDGDKEQNSELRAKYQKLLAASQARQQHLSSLQDYMQRCTNELYWLDQQAKGRMQYD
WSDRNLDYPSRRRQYENFINRNLEAKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHA
DWKEYLNLLICEESHLKYMEDYHQFHKDMKDAQELLRKVDSDLNQKYGPDFKDRYQIELL
LRELDDQEKVLDKYEDVVRGLQKRGQQVVPLKYRRETPLKPIPVEALCDFEGEQGLISRG
YSYTLQKNNGESWELTDSTGNRLIAPAVCFVIPPTDPEALALADSLGSQYRSVQQKAAGS
KRTLQRRYEVLKTENPGDASDLQGRQLLAGLDKVASDLDRQEKAITGVLRPPLEQGRAVQ
DSAERAKDLKNITNELLQIEPEKTRSAAECEAFIQALPGSGTTPLLRTRVEDTNQKYERL
VQLLDLAQEKVDVANRLEKSLQQGWESLATQENRLNQDNTVPESSHALDSKGQELAALAS
ELQAQKSLLGEVERNLQAAKQCSSTLASRFQEHCPDLERQEAEVHKLGQRFDNLCQQVER
RVQSLRSAKAAYEDYRSGHDHMLQFLASIPSYEPQETDSLSQMETKLKNQKNLLDEIARR
EQEVQKIYANSQQYQQAVKDYELEAETLRSLLDLENGRSSHVNKRARLQSPAAKVNEEEA
ALAAKFTEVYAINKQRLQNLEFALNLLRQQLEVEVTHETLQMNKPDSGVEEAWKIRKELD
EEKERRQQLESEIKSTREEIRTLRNQGPQESVVRKEVLKKVPDPALEESFQQLQQTLAEE
QHKNQLLQEELEALQLKVHALEQETRDGGQEYVVKEVLRIEPDRAQADEVLQLREELEAL
RRQKGTREAEVLLLQQRVATLAEEKSRAREKVTEKEVVKLQNDPQLQAEYRQLQDDHERG
RQLHEKQEEELSFLQEKLKRLEKERAMAEGKITVKEVLKVEKDASTEREVSNLTRQYEDE
AAKARASQREKTELLRKIWALEEENAKVVVQEKVREIVRPDPKAESEVANLRLELVEQER
KYRGAEEQLRSYQSELEALRRRGPQVEVKEVTKEVIKYKTDPEMEKELQRLREEIVDKTR
LIERCDLEIYQLKQEIQALKDTKPQVQTKEVVQEILQFQEDPQTKEEVESLRAKLSEEQK
RQVDLERERASQEEQIARKEEELSQVKERVVQQEVVRYEEEPGLRAEVSSFAESIDVELR
QIDKLRAELRRLQRRRTELERQLEELERERQARREAEREVQRLQQRLAVLEQEEAEALEK
VTRKQKVVLQQDPQQAREHALLRLQLEEEQHRRQLLEGELETLRRKLAALEKAEVKEKVV
FSESVQVEKGNTEQEIQRLKSSLEEESRSKRELDAEVSRLEARLSELEFRNSKSSKELDF
LREENHKLQLERQNLQLETRRLQSEIEMAATETQDLRNMTVADSGTNHDSRLWSLERELD
DLKRLSKDKDLEIDELQRRLGSVAVKREQRENHLRRSIVVIHPDTGRELSPEEAHRAGLI
DWSMLVKLKSQECDWEEISVKGPNGESSVIHDRKSGKKFSIEEALQSGRLTPAQYDRYVN
KDMSIQELAVLVSGQK
Download sequence
Identical sequences F7BKB3
ENSCJAP00000037145 ENSCJAP00000037148 XP_002755920.2.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]