SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037191 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037191
Domain Number 1 Region: 223-246
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000327
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037191   Gene: ENSCJAG00000019988   Transcript: ENSCJAT00000039276
Sequence length 253
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:30927080:30938010:1 gene:ENSCJAG00000019988 transcript:ENSCJAT00000039276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSRTDRGSLLQNAAAADVPRNVPEMEWREPHPRCPPPRRKRKQNPRVPLPHCPPNPAAA
IAAATMPKRKKQNQHQPPSQQQPPLPEREDTGDEEDGSPIGPPSLLGPPPMANGKPGDPK
SAFHRGPPGSRGPLIPPLLSLPPPPWGRGPIRGGLGPRSSPYGRGWWGVNAEPPFPGPGH
GGPTRGSFHKEQRNPRRLKSWSLIKNTCPPKDDPQVMEDKSDRPVCRHFAKKGHCRYEDL
CAFYHPGVNGPPL
Download sequence
Identical sequences F7A0X3
ENSCJAP00000037191 ENSCJAP00000037191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]