SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037543 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037543
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 9.28e-56
Family Globins 0.000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037543   Gene: ENSCJAG00000020187   Transcript: ENSCJAT00000039658
Sequence length 147
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:68691489:68705254:-1 gene:ENSCJAG00000020187 transcript:ENSCJAT00000039658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFTAEEKAAITSLWGKMNVEEAGGEALGRLLVVYPWTQRFFDNFGNLSSPSAILGNPK
VKAHGKKVLTSFGDAIKNMDNLKTTFAKLSELHCDKLHVDPENFKLLGNVLVIILATHFG
KEFTPEVQAAWQKLVSAVAIALGHKYH
Download sequence
Identical sequences F6X4Z3
ENSCJAP00000037543 ENSCJAP00000037543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]