SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037562 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037562
Domain Number 1 Region: 4-147
Classification Level Classification E-value
Superfamily Globin-like 3.25e-53
Family Globins 0.000000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037562   Gene: ENSCJAG00000020208   Transcript: ENSCJAT00000039678
Sequence length 147
Comment pep:known chromosome:C_jacchus3.2.1:11:68677645:68679170:-1 gene:ENSCJAG00000020208 transcript:ENSCJAT00000039678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNFTAEDKAAITSLWAKVNVEDAGGETLGRLLVVYPWTQRFFDSFGSLSSPSAIMGNPK
VKAHGVKVLTSLGEAIKNLDDLKGTFGQLSELHCDKLHVDPENFRLLGNVLVTVLAILYG
KEFTPEVQASWQKMVAGVASALASRYH
Download sequence
Identical sequences B0VXB5 Q9GJS7
ENSCJAP00000037562 XP_009005812.1.60252 XP_009005813.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]