SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037952 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037952
Domain Number 1 Region: 348-771
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.72e-108
Family Phosphofructokinase 0.00000698
Further Details:      
 
Domain Number 2 Region: 22-355
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.12e-105
Family Phosphofructokinase 0.000000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037952   Gene: ENSCJAG00000020417   Transcript: ENSCJAT00000040091
Sequence length 783
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:1941253:2013865:1 gene:ENSCJAG00000020417 transcript:ENSCJAT00000040091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDADHSQGPKGSLRKLLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCQAFRTRDGRLKARNLVQRGITN
LCVIGGDGSLTGANLFRKEWSGLLEELAKNGQIEKEAVQRYAHLNVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPE
SPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKDLVVTQLGYDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLSGNHAVRLPLMECV
QMTQDVQKAMDERRFQDAVQLRGKSFEGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGAP
AAGMNAAVRSAVRMGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKR
VLPGKYLEEIATQMRMHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSN
NVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGAD
AAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKGV
FDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKAARGRGKKFTTDDSVCVLG
ISKRNVIFQPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQP
WSV
Download sequence
Identical sequences F6UP74
ENSCJAP00000037952 ENSCJAP00000023025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]