SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038289 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038289
Domain Number 1 Region: 938-1267
Classification Level Classification E-value
Superfamily NHL repeat 2.88e-24
Family NHL repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 1238-1258,1285-1485
Classification Level Classification E-value
Superfamily NHL repeat 0.000000314
Family NHL repeat 0.016
Further Details:      
 
Domain Number 3 Region: 375-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000037
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number 4 Region: 633-705
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000902
Family Carboxypeptidase regulatory domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000038289
Domain Number - Region: 441-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 344-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 473-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 309-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00145
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 506-542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00164
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 279-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0312
Family EGF-type module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038289   Gene: ENSCJAG00000020589   Transcript: ENSCJAT00000040454
Sequence length 2471
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:112312113:112630922:-1 gene:ENSCJAG00000020589 transcript:ENSCJAT00000040454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTFSRHAFTFNKPYRCCNWKC
TALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGELYANGVSKGNRGTESMDTTYSPI
GGKVSDKSEKKELVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRFQITIHHPIYLKFNISL
AKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKSSDDTQHSPRNLILTSLQETGF
IEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNGECISGHCHCFPGFLGP
DCARDSCPVLCGGNGEYEKGHCVCRHGWKGPECDVPEEQCIDPTCFGHGTCIMGVCICVP
GYKGEICEEEDCLDPMCSNHGICVKGECHCSTGWGGVNCETPLPICQEQCSGHGTFLLDT
GVCSCDPKWTGSDCSTELCTMECGSHGVCSRGICQCEEGWVGPTCEERSCHSHCTEHGQC
KDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQNGWHCVCQVGWSGTGCN
VVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYVSPLCQGSPDPLDLIQQSQPLFSQHTS
RLFYDRIKFLIGKDSTHVIPPEVSFDSRRACVIRGQVVAVDGTPLVGVNVSFLHHSDYGF
TISRQDGSFDLVAIGGISVVLIFDRSPFLTEKRTLWLPWNQFIVVEKVTMQRVVADPPSC
DISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIPIPSSFVRLSYLSSRTPGY
KTLLRILLTHSTIPAGMIKVHLTVAVEGRLTQKWFPASTNLVYTFAWNKTDIYGQKVWGL
AEALVSVGYEYETCPDVILWEQRTVVLQGFEMDASNLGGWSLSKHHIFNPQSGIIHKGNG
ENMFISQQPPVISTIMGNGHQRSVACTNCNGPAHNNKLFAPVALASGPDGSVYVGDFNFV
RRIFPSGNSVSILELSTSPAHKYYLAMDPVSESLYLSDTNTRKVYKLKSLMETKDLSKNF
EVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITVDRHGFIYFVDGTMIRRIDENAVI
TTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLYVLDNNIVLQISENRRV
RIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAITVSHSGLLFIAETDERKVNRIQQVT
TNGEISIIAGAPTDCDCKIDPNCDCFSGDGGYAKDAKMKAPSSLAVSPDGTLYVADLGNV
RIRTISRNQAHLNDMNLYEIASPADQELYQFTVNGTHLHTLNLITRDYVYNFTYNAEGDL
GAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKRVSAQGYNLALMTYPGK
HKDFLATKSNDYNGWTVVYMYDPEGHLTNATFPTGEVSSFHSDLEKLTKVELDTSNRENV
LMSTNLTATSTIYILKQENTQSTYRVSPDGSLRVTFASGMEISLSSEPHILAGAVNPTLG
KCNISLPGEHNANLIEWRQRKEQNKGNISAFERRLRAHNRNLLSIDFDHITRTGKIYDDH
RKFTLRILYDQTGRPILWSPVSRYNEVNITYSPSGLVTFIQRGTWNEKMEYDQSGKIISR
TWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQPDCLLSVTMPSMVRHSLQTMLSVGYYR
NIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYTKQARLSEILYDTTQVTLTYEE
SSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARFDYSYNNFRVTSMQAV
INETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTKIFSANGQVIEVQYE
ILKAIAYWMTIQYDNVGRMVICDIRVGVDANITRYFYEYDADGQLQTVSVNDKTQWRYSY
DLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQRGNDVFEYNSNGLL
QKAYNKASGWTVQYYYDGLGRRVASKSSLGQHLQFFYADLANPIRVTHLYNHTSSEITSL
YYDLQGHLIAMELSSGEEYYVACDNTGTPLAVFSSRGQVIKEMLYTPYGDIYHDTYPDFQ
VIIGFHGGLYDFLTKLVHLRQRDYDVVAGRWTTPNHHIWKQLNLLPKPFNLYSFENNYPV
GKIQDVAKYTTDIRSWLELFGFQLHNVLPGFPKPELENLELTYELLRLQTKTQEWDPGKT
ILGIQCELQKQLRNFISLDQLPMTPRYNDGRCLEGGKQPRFAAVPSVFGKGIKFAIKDGI
VTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTHYFIKLGSLEEDLVLIGNTGGR
RILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRA
VAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNI
HFMRQSEIGRR
Download sequence
Identical sequences F7IL83
ENSCJAP00000038289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]