SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038427 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038427
Domain Number 1 Region: 37-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.51e-72
Family Calponin-homology domain, CH-domain 0.0000184
Further Details:      
 
Domain Number 2 Region: 301-421
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-29
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 3 Region: 1258-1410
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-27
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 4 Region: 1569-1703
Classification Level Classification E-value
Superfamily Spectrin repeat 1.64e-26
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 5 Region: 2839-2987
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-25
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 6 Region: 2947-3098
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-24
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 7 Region: 2517-2675
Classification Level Classification E-value
Superfamily Spectrin repeat 4.53e-23
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 8 Region: 1690-1828
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-21
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 9 Region: 1151-1305
Classification Level Classification E-value
Superfamily Spectrin repeat 7.8e-21
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 10 Region: 593-737
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-20
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 11 Region: 3529-3638
Classification Level Classification E-value
Superfamily PH domain-like 7.74e-20
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 12 Region: 3156-3309
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-20
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 13 Region: 2733-2885
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-19
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 14 Region: 2117-2247
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-19
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 15 Region: 3264-3413
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-18
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 16 Region: 2308-2459
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-18
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 17 Region: 857-991
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-18
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 18 Region: 1886-2033
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000035
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 19 Region: 742-819,851-896
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000298
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 20 Region: 418-533
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000156
Family Spectrin repeat 0.00073
Further Details:      
 
Domain Number 21 Region: 1047-1201
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000312
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 22 Region: 3418-3482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000273
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 23 Region: 1416-1503
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000849
Family Spectrin repeat 0.002
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000038427
Domain Number - Region: 2065-2143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000157
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number - Region: 2250-2296
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0118
Family Spectrin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038427   Gene: ENSCJAG00000020664   Transcript: ENSCJAT00000040596
Sequence length 3640
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:33998288:34044141:1 gene:ENSCJAG00000020664 transcript:ENSCJAT00000040596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQPHSPRELLRAAGRPSRRPSTELQAPPSPAATVDSQYEMGHVRKLQARHMKMQEKTF
TKWINNVFQCGQASVGIKIRNLYTELADGTHLLRLLELISGEALPPPSRGRMRVHFLENS
SRALAFLRAKVPIPLIGPENIVDGDQTLILGLIWVIILRFQISHISLDREEFGASAALLS
TKEALLVWCQRKTASYTNVNITDFSRSWSDGLGFNALIHAHRPDLLDYGSLRPDRPLHNL
AFAFLVAEQELGIAQLLDPEDVAAAQPDERSIMTYVSLYYHYCSRLHQGQTVQRRLAKIL
LQLQETEILQTQYEQLVTDLLRWIAEKQAQLEARDFPNSLPAMRQLLAAFASFRTQEKPP
RLQQRGAAEALFFRLQTALQAQNRRPFLPHQGLDLVELSQCWAGLEWAEAARSQALQHRL
LQLERLETLARRFQRKAALRESFLKDAEQVLDQAGAPPASLAAVEAAVQRLGMLEAGILP
QEGRFQALAEIADILQQEQYHSWADVAHRQEEVTLRWQRLLQCLQGQRKQVADMKAVLSL
LQEVEAAFKQLEELQELASSTTCGQQLAEVVELLQRHDLLEAQVSAHGAHVTHLAQEAAE
LDSLLGTSVEVLQAKARTLAQLHQSLVALVKARRALLEQTLQRAEFLRNCEEEEAWLKEC
RQRVGNAALGRDLHQIAGALQKHKALEAEVHRHQAVCVDLVRRGRDLSTRGPATQPDPGE
RAEAVQCSWQLLRTCVAEEGAQLQTALLVLQYFADAADAASWLSEQRSSLESASCGQNQT
AAEALLRRHMRQERVLFAFAAELQRLEEQARVASARASFTVKSAPSPPGESLRNPRPRSE
ASCWEVMALPAEPDPGFDPNTILQTQDRLSQDYESLRALAELRRAQLEEAMALFGFCSSC
EELQSWLEEQTALLQRMQPQVDSVEVTQLKYENFLTALTVGKGLWAEVSSSAEQLKQRYP
GDATKIQREQEELRQRWGQLEVLKQEKAMQLARSAEVHSFLQECGPTQIQLQDVLLQLEA
LQPGSSEDTHRTLQLAWKKTLMLERRVHLLQRVVIKVEESGHAESQPLQGQVETLQGLLK
QVQEHVARQAQGQAEAQTRNSLLQESLRLRLWAERIHAQLHSKEEPVDVASAQRQLWEHG
DLLEEIHLWRERLQQLDAQSQPIAALDSPDCQEVANTLRLLGQQGQELKAMWEQRQQCLQ
EGLELQRFGREVDGFTATCANHEAWLHLDNLGEDVMGTLSLLQQHRESEQLLSSLGPRAE
ALWAHGEKVVRSQHPAAYTVREQLQSVQAQWTRLQTRSEQRKRQLLASLQLQEWKRDVAE
LMQWMEEKGLLAAHEPSGAPQNILQTLKRHEAAECELLATRRHVEALQQAGRELLSRRPH
GQEDIQTRLQGLRSKWEALNCKMAERGDKLRQAGQEEQLLRQLQDAKEQLEQLEGALQSS
ETGQDLLSSKRLQRRHHQLESESQALASKMTTLASQAHSMATSLAILEDTQKYLQRLEFL
QGQLAIQGLQLQASVELHQFCHLSNTELSWVAEHMPHGSPTRSAECLDGVQSLLRKHKVL
QVEVRAHQGQVQRVLSSGRSMAASGHPQAPSIVEKCQELEGRWAELERACEARAQCLQQV
VAFQQYFLDASELEGWVEEKRPLVSSRDYGRDEAATLGLIKKHKVLQEELAVHWSSVEEL
DWRAQTLTGPEAPEQQRVVQERLREQLRALQELAATRGRELEGTLKLHEFLREAKDLQNW
LASQKQAAKGGESLGEDPEHTLHLCTKFAKFQRQVETGGQRVAACRLLAESLLERGHSTG
PMARQRQQDLQATWSELWELTQARGRLLRDAETALRVHRDLLEVLTQVQEKATSLPNKVA
RDLRGLEAQLRSHQGLERELMGTERQLQELLETAGRVQKLCPGPQTHAVQQRQQAVMQAW
AVLQRRMKQRRAQLERARLLARFRSAVRDYTSWAARVRQELQVEESSPEPSSAPLKLSAH
QWLRAELEAREKLWQRASQLGQQALLGAGAPAKEAGHASHTVHRMRHRHLLTWAPVFIQL
CAQAQWALPRPCYAQSAARAGWKVSLKTSPLGSSVEEVEQLIRKHKIFLKVLTAQDKKEA
ALRERLKAFRGPRGQDPLPAVLQLRARVKELAESRGHALCASLLMASFIQAATQAEDWIQ
VQAQRLKEPISAGDLREKLKPLLRHQAFEAEVRAHEEVLISVAKKGEDLLAQSHPRAGEV
SQWLQGLQKQWEDLRQAVALRGQELEDKRKFLEFLQRVDLAEAWIQEKEVMVSAGDLGQD
LEHCLQLRRRLHEFQGASAGSGPVDSIIQTISDLSLQLKSRDPEEVKIICQRRSQLNTGH
FHGNMLRYQQQLEGALEIHTLSRELDNVTERIREKDALIQALDCGKDLESMQRLLWKHEE
LEREIHPIQTQVESLEHEVGLLCQRSPEAAHGLRHRQQEMTSSWWQLRSRAQKRREALDA
LHQAQNLQAMLQKLLVGAQRLRTQMDVSPTPRSPVEARRMLEEHQEHKAELDSWTDSISL
ARSTGQRLLTAGHPSTPDIRQALAGLEQELSSLERAWQEHQQQLQQALELQAGTLFLSSV
EKMERWLCSKEDAPGSEVLWDPSAPVEPLLWKHKMLEQDLEAQAGKISALEAAAHSLQQG
GHPKAQSALGRCQAMLLRKEALFRQARTRRHRLEELQQLQAFLQDSQEAAAWLREKNLVA
LEEGLLDPATLPAQMRKQQNFQAELDVSMHQQQELQREGQKLLQMGPPASEAIQQRLQEL
GALWGELQANFQKKAAKLQKACEAQCLRRSMEELSSWLDPIDVELRAPIGGQALPGVGEL
LGTQVELEAAMDKKARQAEALLGQAQALVREGHWLAQDVEEQAWQLLQRVKSLREPLQER
RTALEAQSLLLQFFRDADEEMAWVQEKLPLATSQDYGQSLSAVRQLQEQHQNLEREMSSH
EALTRVVLGTGHKLVQAGHFAAHEVAARVQQLEKAVGRLQAEAVRRRLLLQEAQEAQQFL
TELLEAGSWLAERGHVLDSEDVGHSAEATQALLRRLEATRRDLEAFSPHIERLQQTAAHL
ESRKNPESPRVLAQLQAVREAHAELLRRAEGRGHGLQEQLQLHQLERETLLLHAWLTTKA
ATAESRDYGQDLEGVTVLEEQFDAFRKEVQSLGQAKVQALRKLAGTLERGAPRSYPHIQA
QRSRIEAAWERLDKAIQARTENLAAAHEVYTFEQAVAELQGRMREKTALMKGEDGGHSQS
SVQTLQQQQRRLERELAAMEKEVARVHMEAGRLGQLHPAAQGGLAERLAKVQEAWATLQL
KAQERGRWLAQAAEGHVFLGRCRELLARAQERQELASSEELAEDVAGAEQLLEQHEELGQ
EIKECCLQAQDLWQEGQQLVDDSHFMSLEVTECLQELEGRLQELQEAWALRQQCCAKSWG
LQKLRQELEQAEAWLASREGLLLEPDYGHSVSDVELLLHRHQDLEKLLAAQEEKFAQMQR
KTEMEQELLLPLQELKPRRAGSLLTSFQWRISGHQGPGAQLAETEGPQNAEGTPTMEGSL
EFKQQLLPGGKQPSSSSWDSCRGALHSSSLSLFLDERMAAEKVASMVLLDLTGAQCERLW
GHHGRKHTFSLRLTSGAEILFAAPSEEQAESWWRALASAA
Download sequence
Identical sequences F7HQB5
ENSCJAP00000038427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]