SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038587 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038587
Domain Number 1 Region: 6-184
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.98e-59
Family Eukaryotic proteases 0.0000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038587   Gene: ENSCJAG00000016610   Transcript: ENSCJAT00000040765
Sequence length 185
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:42852896:42875320:-1 gene:ENSCJAG00000016610 transcript:ENSCJAT00000040765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSQEDENKIIGGYTCARSSQPWQVALLAGPGRRFLCGGALLSDRWVITAAHCGRLILRVA
LGKHNLKRWEATQQELRVVRQVTHPNYNSRTHDNDLMLLQLQQPARMGRAIRPIEVAQAC
ASPGTSCRVSGWGTTSSPIVSYPKTLQCANIQLRSDEECHRVYPGKITANMLCAGTKEGG
KDSCE
Download sequence
Identical sequences F7I6V7
ENSCJAP00000038587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]