SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038687 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038687
Domain Number 1 Region: 207-270
Classification Level Classification E-value
Superfamily BPTI-like 1.14e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0046
Further Details:      
 
Domain Number 2 Region: 349-410
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0057
Further Details:      
 
Domain Number 3 Region: 301-339
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038687   Gene: ENSCJAG00000020793   Transcript: ENSCJAT00000040868
Sequence length 498
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:35032047:35049339:-1 gene:ENSCJAG00000020793 transcript:ENSCJAT00000040868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAPARMMACACLVPAHCLNRFTAGVPDFVLDTNASVSNGATFLEFPTVRRGWDCVRACCT
TQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVYRSYRQLR
TQGFGGSGIPKTWASMDLKVQPQEPVVLKDAENTDWHLLRGDTDVRVERKDPNQVELWGL
KEGTYLFQLTMTSSDQPEDTANITVTVLSTKQTEDYCLASSKVGRCRGSFPRWYYDPTEQ
ICKSFTYGGCLGNKNNYLREEECILACRGVQGGPLRGSSGAQATFPQGPSMERRHPVCSG
TCQPTQFRCSNGCCIDSFLECDDTPNCPDASDEATCEKYTSGFDELQSIHFPSDKGHCVD
LPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNENNFEEEQQCLESCRGISKKDVFGLR
RESPIPTTGSVEVAVAAFLIICIVVVVAILGYCFFKDQRKNFHRHHHRHHPPPTPAGSTV
STTEDTEHLVYNHTTRPL
Download sequence
Identical sequences F7ISZ5
ENSCJAP00000038687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]