SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038752 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038752
Domain Number 1 Region: 25-133
Classification Level Classification E-value
Superfamily PWI domain 3.01e-44
Family PWI domain 0.000000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038752   Gene: ENSCJAG00000020822   Transcript: ENSCJAT00000040934
Sequence length 925
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:58688610:58717331:1 gene:ENSCJAG00000020822 transcript:ENSCJAT00000040934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL
GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP
SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRERSRSPRRRKSRSP
SPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATS
TSDILKVPKPEPVPEPKEPSPEKNSKKEKEKEKTRPRSRSRSKSRSRTRSRSPSHTRPRR
RHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVRRRRRSSASLSGSSS
SSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSPPATPPPKTRHSPTPQQS
NRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQ
QRRQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKET
SPRMQMGKRWQSPVTKRFSGRRRRSPTPPPTRRRRSPSPAPPPRRRRSPTPPPRRRTPSP
PPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKHRVSHSPPPKQR
SSPVTKRRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSSPPPVRRGT
SSSPQRRQSPSPSTRPIRRVSRTPEPKKIKKGMLPKETGDVIGHVSRINQQSKWSRAASP
SPQSIRRVSSSRSVSGSPEPAVKKPPAPPSPIQSQSPSTNWSPAVPIKKAKSPTPSPSPP
RNSDQEGGDKKHKKEKAVAAAAAAALTPAAITTATTTLAQEEPVAVPEPKKETESEAEDN
LDDLEKHLREKALRSMRKAQVSPQS
Download sequence
Identical sequences F7IG52
ENSCJAP00000038752 ENSCJAP00000038752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]