SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038823 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038823
Domain Number 1 Region: 70-126
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.97e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038823   Gene: ENSCJAG00000020866   Transcript: ENSCJAT00000041010
Sequence length 197
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:6542042:6549108:-1 gene:ENSCJAG00000020866 transcript:ENSCJAT00000041010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGLEAARRGPGPGGGRRAG
GDAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIA
HLANVLLLGDAADDGQPCFRAAGGAKSAVPAAADGGRQPRSICTFCLSNQRKGGGRRDLG
GSCLKVRGVAPLRGPRR
Download sequence
Identical sequences F7I4D0
XP_008993852.1.60252 ENSCJAP00000038821 ENSCJAP00000038823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]