SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038988 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038988
Domain Number 1 Region: 142-460
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.13e-113
Family Transglutaminase core 0.000000000035
Further Details:      
 
Domain Number 2 Region: 3-139
Classification Level Classification E-value
Superfamily E set domains 1.01e-41
Family Transglutaminase N-terminal domain 0.000000399
Further Details:      
 
Domain Number 3 Region: 483-595
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.16e-32
Family Transglutaminase, two C-terminal domains 0.00000154
Further Details:      
 
Domain Number 4 Region: 595-693
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.7e-26
Family Transglutaminase, two C-terminal domains 0.00000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038988   Gene: ENSCJAG00000020950   Transcript: ENSCJAT00000041184
Sequence length 694
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:8122458:8170493:1 gene:ENSCJAG00000020950 transcript:ENSCJAT00000041184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALELQSINWQTAFNRQAHHTDKFSSQELILRRGQNFEVLMVMNKGLGSRERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTVTINISSPASAPIGRYTMALQISSQ
GGVSSVNLGKFILLFNPWLNVDSVFMGNHAEREEYVQEDAGIIYVGSTNRISMIGWNFGQ
FEEDILSICLSILDRSLNYRRDAATDVAHRNDPKYVGRVLSAMINSNDDNGVLTGNWSGN
YTGGRDPRNWNGSVEILKDWKKSGFRPVRFGQCWVFAGTLNTALRSLGIPSRVITNFNSA
HDTDRNLSVDVYYDPMGNPLDKGSDSMWSFNHIHGSQWIVRSDLGPSYSGWQVLDATPQE
RSQGVFQCGPASVIGIREGDVNLSFDMPFIFAEVNADRITWLFDSNTGTQRKNSVDSRSI
GRYISTKAVGSNARMDITDKYKYPEGSEEERGVFQKALGKLKPNASFGATSSTGSETEEQ
EPSISGKFKVTGSLEVGKEVNLVLQLKNLSSDRKRVTVNMTAWTIVYNGTLVHEVWKDSA
TMSLDPEEEAEYPVKISYAQYEKYLKSDNMIRITAVCKVPDEPEVVVERDVILDNPTLTL
EVLSEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLRPKERSRVRF
EILPTRSGTKQLLADFSCNKFHAIKAMLSIDVAE
Download sequence
Identical sequences F7IIH0
ENSCJAP00000038977 ENSCJAP00000038988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]