SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039008 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039008
Domain Number 1 Region: 143-460
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.37e-124
Family Transglutaminase core 0.00000000444
Further Details:      
 
Domain Number 2 Region: 3-141
Classification Level Classification E-value
Superfamily E set domains 5.25e-43
Family Transglutaminase N-terminal domain 0.0000956
Further Details:      
 
Domain Number 3 Region: 494-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.23e-27
Family Transglutaminase, two C-terminal domains 0.00028
Further Details:      
 
Domain Number 4 Region: 608-703
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-23
Family Transglutaminase, two C-terminal domains 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039008   Gene: ENSCJAG00000020966   Transcript: ENSCJAT00000041204
Sequence length 706
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:8211242:8256108:1 gene:ENSCJAG00000020966 transcript:ENSCJAT00000041204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIRVTKVDWQRLRNGAAHHTQEYPCPELVIRRGQSFSLTLELSRDPDCEETLIFTVET
GPRASEALHTKAVFQTSELDGGEGWTAAKEAQMENTLTVSLTSPPNAVIGRYLLSTRLSS
HRKHSNRRLGEFILLFNPWCAEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRAQGWNYG
QFEEDILNICLSILDRSPSHQDNPATDVSCRHDPIYVTRVISAMVNSNNDQGVVQGQWQG
RYGGGTSPLHWRGSVAILQKWFKGRHKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNS
AHDTDQNLSVDKYVDFFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQ
EESEGVFRCGPASVAAIREGDIHLAHDGPFVFAEVNADYITWLWHEDESRERVYSDTKKI
GRCISTKAVGSDLRVDITGLYKYPEGSRKERQVYSKAVKRLFSVEASGRRTQIRRAGGRC
LRRDDLLEPATKPSITGKFKVLEPPMLGHDLRLALCLANLTSRAQWVRVNLSGATILYTR
KPVAEILHESHTVRLGPKEEKRIPIAISYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEK
DITLEDFITIKVLGPAVVGVAVTVEVTVVNPILERVKDCALMVEGSGLLQGQLSINVPTL
EPQERTSVQFDITPSKSGARQLQVDLVSPHFPDVKGFVIIHVATTK
Download sequence
Identical sequences F7FUN4
XP_008993887.1.60252 ENSCJAP00000039008 ENSCJAP00000039005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]