SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039182 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039182
Domain Number 1 Region: 291-621
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.45e-75
Family Pancreatic carboxypeptidases 0.0000017
Further Details:      
 
Domain Number 2 Region: 112-275
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.34e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00047
Further Details:      
 
Domain Number 3 Region: 622-719
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.75e-17
Family Carboxypeptidase regulatory domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039182   Gene: ENSCJAG00000021048   Transcript: ENSCJAT00000041391
Sequence length 732
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:8564020:8570393:-1 gene:ENSCJAG00000021048 transcript:ENSCJAT00000041391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWALLLLFAFAPAVGPALGAPGNSVLGLAPPATTEVPGSIPTPPSRPAQLPAGTANGTSE
QHVRIRVIKKKKIIMKKRRKLTHPTPLVTAKPLVTSSPGGSLNSHEKQEPGCPPLGLESL
RVSDSRLEASSSQSFGLGPHRGRLNIQSGLEDGDLYDGAWCAEEQDANPWFQVDAGHPTR
FSGVITQGRNSVWRYDWVTSYKVQFSNDSRTWWGSRNHSSGMDPQVFPANSDPETPVLNL
LPEPQVARFIRLLPQTWLQGGASCLRAEILACPVSDPNDLFLEAPAWGSSDPLDFRHHNY
KAMRKLMKQVNEQCPNITRIYSIGKSYQGLKLYVMEMSDRPGEHELGEPEVRYVAGMHGN
EALGRELLLLLMQFLCHEFLRGNPRVTRLLTEMRIHLLPSMNPDGYEIAYRRGSELVGWA
EGRWNIQSIDLNHNFADLNTPLWEAQDEGQVPHIVPNHHVPLPTYYTLPNATVAPETRAV
IEWMKRIPFVLSANLHGGELVVSYPFDMTRSPWAARELTPTPDDAVFRWLSTVYAGSNLA
MQDTSRRPCHSQDFSMYGNIINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHESE
LPQEWENNKDALLTYLEQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGDYWR
LLTPGDYMVTASAEGYHSVTRSCRVTFEEGPFPCNFVLTKTPKQRLRELLAAGAKVPPDL
RRRLERLRGQKD
Download sequence
Identical sequences F7GZY7
ENSCJAP00000039182 ENSCJAP00000039182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]