SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039275 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039275
Domain Number 1 Region: 41-115
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000373
Family Rhamnogalacturonase B, RhgB, middle domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039275   Gene: ENSCJAG00000021103   Transcript: ENSCJAT00000041493
Sequence length 241
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:43322063:43341846:-1 gene:ENSCJAG00000021103 transcript:ENSCJAT00000041493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALWGFFPVLLLLLSGDVQSSEMPGAAAEGSVGSGVGIGDRFKIEGRAVVPGVKPQDW
ISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRAR
YVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPK
VVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKSGKSGAGKR
R
Download sequence
Identical sequences F7F1K2
ENSCJAP00000039275 XP_002807249.2.60252 ENSCJAP00000039275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]