SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039282 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039282
Domain Number 1 Region: 496-826
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.83e-100
Family PDEase 0.000000543
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 3.6e-32
Family GAF domain 0.00047
Further Details:      
 
Domain Number 3 Region: 237-289,321-458
Classification Level Classification E-value
Superfamily GAF domain-like 7.85e-30
Family GAF domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039282   Gene: ENSCJAG00000021102   Transcript: ENSCJAT00000041501
Sequence length 855
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:47310352:47399147:-1 gene:ENSCJAG00000021102 transcript:ENSCJAT00000041501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKIISDLLGAKEAAVDFSKYHSLSSVEESEI
IFDLLRDFQENLQTEKCIFNVMKKLCFLLQADRMSLFMYRTRNGIAELATRIFNVHKDAV
LEDCLVMPDQEIVFPLDMGVVGHVAHSKKIANVPNTEEDEHFCDFVDILTEYKTKNILAS
PIMNGKDVVAIIMAVNKVDGSHFTKRDEEILLKYLNFANLIMKVYHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEVP
PYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPTYVAQNGLICNIM
NAPAEDFFAFQKEPLDESGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLTQFLGWSVLNPDTYESMNRLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPW
ECEEEELTEILQAELPDAEKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQE
ALVRFMYSLSKGYRKITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKMYESEQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSKLELQVGGSRGRVSVLQQNPIPMMDRNKADELPKLQVGFIDFVCTFVY
KEFSRFHEEITPMLDGITNNRKEWKALADEYEAKMKAQEEEKQKQQAAKPVAAGNQRGGD
PSPGGATTSKSCCIQ
Download sequence
Identical sequences F7F1D6
ENSCJAP00000039282 ENSCJAP00000039282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]