SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039316 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039316
Domain Number 1 Region: 31-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000746
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039316   Gene: ENSCJAG00000021123   Transcript: ENSCJAT00000041535
Sequence length 257
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:74515623:74547365:-1 gene:ENSCJAG00000021123 transcript:ENSCJAT00000041535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKASPPPQGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCV
MPEDVKNFYLMTNGFHMTWSVKLDASDDQPEKPHFDSRSVIFELDSCNGNGKVCLVYKSG
KPALAEDTEIWFLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFS
MYKPINYNTNLLTEETDSFVNKLDPSKVFKSKNKIIIPKKKGPVQPSGTQKGSSGPSGPS
TSSNSKSSSGSGNPVRK
Download sequence
Identical sequences F7DE79
ENSCJAP00000039316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]