SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039488 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039488
Domain Number 1 Region: 28-111
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000549
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 2 Region: 204-286
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000924
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039488   Gene: ENSCJAG00000021205   Transcript: ENSCJAT00000041714
Sequence length 296
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:4986441:5100363:-1 gene:ENSCJAG00000021205 transcript:ENSCJAT00000041714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTYLTSIPSVEAASIGFIVVIDRRRDKWSSVKASLTRIAVAFPGNLQLIFILRPSRFIQR
TFTDIGIKYYRNEFKTKVPIILLNSVSDLHGYIDKSQLTQELGGTLEYRHSQWVNHRTAI
ENFALTLKTTVQMLQTFGASLATTELPRSMLSTEDLLMSHTRQRDKLQDELKLLGKQGAT
LLSCIREPATKYPNSKLNLNQLENVAALERLLVQLHETEKAFSEFWSKHHLKLNQCLQLQ
HFEHDFCKVKLALDNLLEEQAEFTGIGDSVMHVEQLLKEHRKLEEKSQDPMERSTL
Download sequence
Identical sequences F7FDT8
ENSCJAP00000039488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]