SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039491 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039491
Domain Number 1 Region: 538-737
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.22e-36
Family DBL homology domain (DH-domain) 0.00000494
Further Details:      
 
Domain Number 2 Region: 750-875
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-27
Family Pleckstrin-homology domain (PH domain) 0.00025
Further Details:      
 
Domain Number 3 Region: 235-337
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000537
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 4 Region: 28-111
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000366
Family CRAL/TRIO domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039491   Gene: ENSCJAG00000021205   Transcript: ENSCJAT00000041717
Sequence length 918
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:4864180:5100363:-1 gene:ENSCJAG00000021205 transcript:ENSCJAT00000041717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTYLTSIPSVEAASIGFIVVIDRRRDKWSSVKASLTRIAVAFPGNLQLIFILRPSRFIQR
TFTDIGIKYYRNEFKTKVPIILLNSVSDLHGYIDKSQLTQELGGTLEYRHSQWVNHRTAI
ENFALTLKTTVQMLQTFGASLATTELPRSMLSTEDLLMSHTRQRDKLQDELKLLGKQGAT
LLSCIREPATKYPNSKLNLNQLENVAALERLLVQLHETEKAFSEFWSKHHLKLNQCLQLQ
HFEHDFCKVKLALDNLLEEQAEFTGIGDSVMHVEQLLKEHRKLEEKSQEPLERAQLLALV
GDQLIQSHHDAADAIRSQCVELRHLCDDFINENKKKQDVFGKSLELHRQLDKVSQWCEAG
IYLLASQAVDKCQSREGVDIALNDIATFLGTAKEDPLLSPKEFYDEFELLLTLDAKAKAQ
QVLQRLGDVQEIFHKRQVSLMKLAAKQTRPVQPVAPHPESSPKWLSSKTSQPPTSVPLAP
PLRTSEEPYTEAELNSWGKQDCETNLGVKNEEFFESLRERGNPQLEQPARLRDPSPCRRI
ICDLLETEEIYIKEIKSIIDGYITPMDFIWLKHLIPDVLQNNKDFLFGNMRELYEFHSRT
FLKDLEKCAENPELLAHCFLKRKEELQIYFKYHKNLPRARAIWQECQDCAYFGVCQRQLD
HKLPLFKYLRGPSQRLLKYQMLLKGLLDFESPEDTEIDPSELGGSAKDGPKRTKDSAFST
ELQQALAVIEDLIQSCELVVDLAAVTEYPDDIGKLGELLMHSPFSVWTIHKDRYKMKDLI
RFKPSQRQVYLFEKGIVFCKIQMEPGDQGSSPHYSFKKSLKLMSLSIRQLGRGSHRKFEI
ANRNGLEKYILQAASKEIRDCWFSEISKLLMEQQNDVQDQGNPQFEMSTGKDSGVGCGPW
IENMERAATSKEDPASST
Download sequence
Identical sequences F7FDS3
ENSCJAP00000039488 ENSCJAP00000039491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]