SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039516 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039516
Domain Number 1 Region: 215-625
Classification Level Classification E-value
Superfamily RNI-like 4.84e-43
Family Cyclin A/CDK2-associated p19, Skp2 0.034
Further Details:      
 
Domain Number 2 Region: 153-237
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000222
Family F-box domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039516   Gene: ENSCJAG00000021213   Transcript: ENSCJAT00000041743
Sequence length 690
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:71223357:71532265:-1 gene:ENSCJAG00000021213 transcript:ENSCJAT00000041743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPELMIKACSFYTGHLVKTHFCTWRDITHKNENVALADKMNRAVTCYDFRLQKSVFHHW
HSYMEDQKEKLKNMVLRIQRIIYCHKLTIILTKWRNKARCKNKKKEDELVLKHELQLKKW
RNRLLLKGASAEKSNFPEQSSSEVCLVDETLECDISQLPERAILQIFFYLSLKDVLICGQ
VNHAWMLMTQLSSLWNAIDFSTVKHAIPDKYIVSTLQRWHLNVLRLNFRGCLLRPKTFRS
ASHCRNLQELNVSDCPTFTDESMRHISEGCPGVLYLNLSNTTITNRTMRLLPRHFHNLQN
LSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRYIANSCTGILHLIINDM
PTLTDNCVKALVEKCSHITSMIFTGAPHISDCTFKALSTCKLRKIRFEGNKRITDASFKF
MDKNYPDLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDVGLRQFLDGPASIR
IRELNLSNCVQLSDVSVLKLSERCPNLNYLSLRNCEHLTAQGIAYIVNIFSLVSIDLSGT
DISNEDLNVLSRHKKLKELSVSACYRITDDGIQITDSVMEMLSAKCHYLHILDISGCVLL
TDQILDDLQIGCKQLRILRMQYCTNISKNAAERMSSKVQQQEYNSNDPPRWFRYDREGNP
LTQPENITSSKGHLELTVEKSTYSSEEEAV
Download sequence
Identical sequences F7DUH3
ENSCJAP00000039516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]