SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039554 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039554
Domain Number 1 Region: 24-328,444-494
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.61e-56
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 308-431
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.79e-31
Family L-aminoacid/polyamine oxidase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039554   Gene: ENSCJAG00000021237   Transcript: ENSCJAT00000041787
Sequence length 502
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:9974089:10017299:1 gene:ENSCJAG00000021237 transcript:ENSCJAT00000041787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHI
GGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNHGHRIPKDVVEEFSDLYNEVYNLTQEFFRHDKPVNAESQNSVGVFTREEVRNRI
RDDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHIIPSGFM
RIVELLAEGIPAHVIQLGKPVRCVHWDQASARPRGPEIEPRGVLKRQYTSFFRPGLPTEK
VAAIHRLGIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESRTLTYPPELWYRKICGFDV
LYPPERYGHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWG
SNPYFRGSYSYTQVGSSGADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTHGAL
LSGQREAARLIEMYRDLFQQGT
Download sequence
Identical sequences F7CU10
ENSCJAP00000039554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]