SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039605 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039605
Domain Number 1 Region: 526-604
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000285
Family Canonical RBD 0.016
Further Details:      
 
Domain Number 2 Region: 884-954
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000114
Family Canonical RBD 0.023
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000039605
Domain Number - Region: 286-312
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000106
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number - Region: 5-72
Classification Level Classification E-value
Superfamily PWI domain 0.00262
Family PWI domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039605   Gene: ENSCJAG00000021261   Transcript: ENSCJAT00000041843
Sequence length 1003
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:35151874:35241672:1 gene:ENSCJAG00000021261 transcript:ENSCJAT00000041843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIENFEALKSWLSKTLEPICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVFLQKE
TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRL
NHSPPQSSSRYRENRSRDERKKDDRSRKRDYDRNPPRRDSYRDRYNRRRGRSRSYSRSRS
RSWSKERLRERDRDRSRTRSRSRTRSRERDLVKPKYDLDRTDPLENNYTPVSSVPSISSG
HYPVPTLSSTITVIAPTHHGNNTTESWSEFHEDQVDHNSYVRPPMPKKRCRDYDEKGFCM
RGDMCPFDHGSDPVVVEDVNLPGMLPFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPV
PPPGPLPPSLPPVTGPPPPLPPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFT
ADTYDTDGYNPEAPSITNTSRPMYRHRVHAQRPNLIGLTSGDMDLPPREKPPNKSSMRIV
VDSESRKRTIGSGEPGVPTKKTWFDKPNFNRTNSPGFQKKVQFGNENTKLELRKVPPELN
NISKLNEHFSRFGTLVNLQVAYNGDPEGALIQFATYEEAKKAISSTEAVLNNRFIKVYWH
REGSTQQLQTTASKVMQPLVQQPILPVVKQSVKERLGPVPSSTIEPAEAQSATSDLPQNV
TKLSVKDRLGFVSKPSVSATEKVLSTSTGLTKTVYNPAALKAAQKTLLVSTSAVDNNEAQ
KKKQEALKLQQDVRKRKQEILEKHIETQKMLISKLEKNKTMKSEDKAEIMKTLEVLTKNI
TKLKDEVKAVSPGRCLPKSIKTKTQMQKELLDTELDLYKKMQAGEEVTELRRKYTELQLE
AAKRGILSSGRGRGIHSRGRGAVHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDRE
DLLPHFAQYGEIEDCQIDDSSLHAVITFKTRAEAEAAAVHGARFKGQDLKLAWNKPVTNI
SAVETEEVEPDEEEFQEESLVDDSLLQDDDEEEEDNESRSWRR
Download sequence
Identical sequences F7GZB7
ENSCJAP00000039605 ENSCJAP00000039600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]