SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039628 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039628
Domain Number 1 Region: 318-612
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.77e-52
Family Glycerophosphoryl diester phosphodiesterase 0.0016
Further Details:      
 
Domain Number 2 Region: 6-113
Classification Level Classification E-value
Superfamily Starch-binding domain-like 1.99e-21
Family Starch-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039628   Gene: ENSCJAG00000021287   Transcript: ENSCJAT00000041867
Sequence length 672
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:11218602:11286087:-1 gene:ENSCJAG00000021287 transcript:ENSCJAT00000041867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPSQITFEIRGTLLPGEVFAICGSCDALGNWNPQSALALLPENETGESMLWKATVVLSR
GVSVQYRYFKGYFLEPKTIGGPCQVIVHKWETHLQPRSITPLENKIIIDDGQFGIHNGVE
TLDSGWLTCQTELRLRLHYSEKPPVSITKKKLKKSRFRVKLTLEGLEEDDDDRVSPTVLH
KMSNSLEISLISDNEFKCRHSQPECGYGLQPDRWTEYSIQTMEPDNLELIFDFFEEDLSE
HVVQGDALPGHVGTACLLSSTIAESGKSAGILTLPIMSRNSRKTIGKVRVDYIIIKPLPG
YNCDMKSSFSKYWKPRIPLDVGHRGAGNSTTTAQLAKVQENTIASLRNAASHGAAFVEFD
VHLSKDFVPVVYHDLTCCLTMKKKFDADPVELFEIPVKELTFDQLQLLKLTHVTALKSKD
RKESVVQEENSFSENQPFPSLKMVLESLPEDVGFNIEIKWICQQRDGMWDGNLSTYFDMN
LFLDIILKTVLENSGKRRIVFSSFDADICTMVRQKQNKYPILFLTQGKSEIYPELMDLRS
RTTPIAMSFAQFENLLGINAHTEDLLRNPSYIQEAKAKGLVIFCWGDDTNDPENRRKLKE
LGVNGLIYDRIYDWMPEQPNIFQVEQLERLKQELPELKSCLCPTVSRFVPSSLCGDSAIH
VDANGIDNVENA
Download sequence
Identical sequences F7GP61
ENSCJAP00000039625 XP_008993968.1.60252 ENSCJAP00000039628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]