SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039765 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039765
Domain Number 1 Region: 193-503
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.77e-118
Family Transglutaminase core 0.0000000000154
Further Details:      
 
Domain Number 2 Region: 10-192
Classification Level Classification E-value
Superfamily E set domains 3.46e-57
Family Transglutaminase N-terminal domain 0.0000000187
Further Details:      
 
Domain Number 3 Region: 518-629
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.89e-32
Family Transglutaminase, two C-terminal domains 0.00000286
Further Details:      
 
Domain Number 4 Region: 631-728
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.42e-28
Family Transglutaminase, two C-terminal domains 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039765   Gene: ENSCJAG00000021366   Transcript: ENSCJAT00000042012
Sequence length 733
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:22325167:22491353:1 gene:ENSCJAG00000021366 transcript:ENSCJAT00000042012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTSRISSFGGRRAVPPNNSNAEEDDLPTEEIHSLVPRGVNMEDFLNVTNVHLFKERWD
TNKVDHHTDKYDNNKLIVRRGQPFYMQIDFNRPYDPSRDLFRVEYVIGRYPQENKGTYIP
VPIVPELQSGKWGAKVVMREDNSVRLSVQSSPECIVGKFRMYVAVWTPYGILRTRRNPET
DTYILFNPWCEDDAVYLDDEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDIC
LYVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVVVGSWDNVYAYGVPPSAWTGSVDI
LLEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQMDIFLEEDG
NVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMFRCGPASVQAIK
HGHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVEAVDTTHIGKLIVTKQIGGDGMKDIT
DSYKFQEGQKEERLALETALMYGVKKPFNTEGLIKSRSNVDMDFEVENAVLGQDLKLTIT
FQNKSHRRYTTTAYLSANIIFYTGVSKAEFKKETFSLMLEPLSVKKEEVQIRAGEYLGQL
LEQASLHFFVTARVNETKDVLVKQKSIVLIIPEVIIKVRGAQVVGSDMIVTVEFTNPLKT
TLQNVWIYLDGPGITRPMRKMFREILPNSTVQWEEVCRPWVSGPRKLIASMSSDSLRHVY
GELDVQIQRQPSM
Download sequence
Identical sequences F7HEM8
ENSCJAP00000039765 ENSCJAP00000039765 XP_017826421.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]