SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039989 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039989
Domain Number 1 Region: 2690-2930
Classification Level Classification E-value
Superfamily Plakin repeat 2.75e-87
Family Plakin repeat 0.0000000753
Further Details:      
 
Domain Number 2 Region: 3719-3954
Classification Level Classification E-value
Superfamily Plakin repeat 1.13e-86
Family Plakin repeat 0.0000000263
Further Details:      
 
Domain Number 3 Region: 3140-3378
Classification Level Classification E-value
Superfamily Plakin repeat 1.28e-86
Family Plakin repeat 0.0000000573
Further Details:      
 
Domain Number 4 Region: 176-398
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.6e-86
Family Calponin-homology domain, CH-domain 0.000000605
Further Details:      
 
Domain Number 5 Region: 3477-3714
Classification Level Classification E-value
Superfamily Plakin repeat 3.53e-78
Family Plakin repeat 0.000000747
Further Details:      
 
Domain Number 6 Region: 3988-4029,4064-4258
Classification Level Classification E-value
Superfamily Plakin repeat 3.05e-69
Family Plakin repeat 0.000000298
Further Details:      
 
Domain Number 7 Region: 414-530
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-22
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 8 Region: 756-859
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000912
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 9 Region: 662-755
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000563
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 10 Region: 3018-3092
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000196
Family Plakin repeat 0.0013
Further Details:      
 
Domain Number 11 Region: 1180-1341
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000089
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 12 Region: 1290-1441
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000403
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 13 Region: 857-936,1000-1023
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000528
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039989   Gene: ENSCJAG00000021472   Transcript: ENSCJAT00000042245
Sequence length 4339
Comment pep:novel chromosome:C_jacchus3.2.1:16:50704543:50743676:1 gene:ENSCJAG00000021472 transcript:ENSCJAT00000042245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGMLMPRDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMCAMASLRARGL
VRETFAWRHFYWYLTNEGITHLRQYLHLPPEIVPASLQRVRRPVAMVMPARRTPQVQAVQ
GPLSSPPKRGPLPAEEQRVYRRKEPEKVSPETPVVPATTLGTLARPGPEPAPAPATDERD
RVQKKTFTKWVNKHLIKAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFHKLQ
NVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDMTAK
EKLLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHKPMLIDMNKVYRQTNLENLDQ
AFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPDVQDGVRANELQLRW
QEYRELVLLLLQWIRHHTATFEERRFPSSFEEIEILWCQFLKFKEMELPAKEADKNRSKG
IYQSLEGAVQAGQLKVPPGYHPLDVEKEWGKLHVAILEREKQLRSEFERLECLQRIVSKL
QMEAGLCEEQLNQADALLQSVRGCPAAGRSKVPQRAGEVERDDKADGMIRLLFNDVQTTL
KDGRHPQGEQMYRTVYRLHERLVAIRTEYNLRLKAGVAAPAVQVTQVTLQRRPEPEDSTL
RYLQDLLAWVEENQHRVDGAEWGVDLPSVEAQLGSHRGLHQSIEEFRAKIERARSDEGQL
SPATRGAYRDCLGRLDLQYAKLLNSSKARLRSLESLHSFVAAATKELMWLNEKEEEEVGF
DWSDRNTNMTAKKDSYSDLMRELELKEKKIKELQSAGDRLLREDHPGPGPPVESFQAALQ
TQWSWMLQLCCCIEAHLKENAAYFQFFSDVREAEEQLQKLQETLRRKYSCDRSITVTRLE
DLLQDAQDEKEQLNEYKGHLSGLAKRAKAIVQLKPRHPAYPVRGRVPLLAVCDYKQVEVT
VHKGDECQLVGPAQPSNWKCAQPQAARPPVPSVCFLVPPPNQEAQEAVTRLEAQHQALVT
LWHQLHVDMKSLLWQSLRRDVQLIRSWSLATFRTLKPEEQRQALHSLELHYQAFLRDSQD
AGGFGPEDRLVAEREYGSCSHHYQQLLQSLEQGAQEESRCQRCISELKDIRLQLEACETR
TVHRLRLPLDKEPARECAQRIAEQQKAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPT
LRSELELTLGKLEQVRSLSAIYLEKLKTISLVIRSTQGAEEVLRAHEEQLKEAQAVPATL
PELEATKASLKKLRAQAEAQQPVFDALRDELRGAQEVGERLQQRHGERDVEVERWRERVA
QLLERWQAILAQIDVRQRELEXWGGQACPVAAMLTSALLEEIERHGEKVEECQKFAKQYI
NAIKDYELQLVTYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTRYSELTTLTSQYIKF
ISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAEREAKELQQR
MQEEVVRREEAAVDAQQQKRSIQEELQQLRQSSEAEIQAKARQAEAAERSRLRIEEEIRV
VRLQLEATERQRGGAEGELQALRERAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAE
LALRVKAEAEAAREKQRALQSLEELRLQAEEAERRLRQAEVERARQVQVALETAQRSAEA
ELQSKRASFAEKTAQLERSLQEEHVAVAQLREEAERRAQQQAEAERAREEAERELERWQL
KANEALRLRLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEK
QRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRLLLEEELTRLQREAAAATQKRQELEAE
LAKVRAEMEVLLASKARAEEESRCTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQ
RQLAEEDAARQRAEAERVLAEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQ
RRRLEEQAAQHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEEEILALKASFEK
AAAGKAELELELGRIRSNAEDTLRSKEQAEQEAARQRQLAAEEEQRRREAEERVQKSLAA
EEEAARQRKAALEEVERLKAKVEEARRLRERAEQESTRQLQLAQEAAQKRLQAEEKAHAF
AVQQKEQELQETLQQEQSMLDRLRSEAEAARRAAEEAEEARVQAEREAAQSRRQVEEAER
LKQSAEEQAQAQAQAQAAAEKLRKEAEQEATRRAQAEQAALRQKQAADAEMEKHKKFAEQ
TLRQKAQVEQELTTLRLQLEETDHQKNLLDEELQRLKAEATEAARQRSQVEEELFSVRVQ
MEELSKLKARIEAENRALILRDKDNTQRFLQEEAEKMKQVAEEAARLSVAAQEAARLRQL
AEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQ
LAQETQGFQRTLEAERQRQLEMTAEAERLKLRVAEMSRAQARAEEDAQRFRKQAEEIGEK
LHRTELATQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLQQEAKLLQLKSEEM
QTVQQEQLLQETQALQQSFLSEKDSLLQREHFIEQEKAKLEQLFQDEVAKVAEENQRLRE
QLQRLEEEHRAALAHSEEVTALQVAATKTLPNGQDALDGPAVEAEPKHSFDGLRRKVPAQ
RLQEAGILSAEELHRLAQGHTTVHELARREDVRHYLQGSSSIAGLMLKPTNEKLSIYSAL
QRQLLSPGTALILLEAQAASGFLLDPVQNRRLTVNEAVKEGVVGPELHHKLLSAERAVTG
YTDPYTGQPISLFQAMQKGLIVREHGIRLLEAQIATGGVIDPVHSHRVPVDVAYQRGYFD
EEMNRILADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVY
TDLEARDVFEKATVSAPFGKFQGKTVTIWEIINSEYFTAEQRRDLLRQFRTGRITVEKII
KIIITVVEEQEQKGQLCFEGLRSLVPAAELLESSVINRELYHQLQRGERSVREVAEVDAV
RRALRGAGIIAGVWLEEAGQKLSLYDALKKDLRSEYFTAEQRQELLRQFRTGKVTVEKVI
KILITIVEEVETQRQERLSFSGLRAPVPASELLASGVLSRAQFEQLKDGKTTVKDLSELG
SVQTLLQGSGCLAGIYLEEAKEKVSIYEAMRRGLLRPSTAALLLEAQAATGFLVDPVRNQ
RLYVHEAVKAGVVGPELHEQLLSAEKAVTGYRDPYSGSTISLFQAMQKGLVLRQHGIRLL
EAQIATGGIIDPVHSHRVPVDVAYQRGYFDQEMNRVLADPSDDTKGFFDPNTHENLTYRQ
LLERCVEDPETGLRLLPLKGAEKAEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSTM
SLWEVMQSDLIPKEQRAQLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQGLASYDYVRR
RLTAEDLYEARIISLETYNLLREGTRSLREVLEAESAWRYLYGTGCVAGVFLPGSRQTLS
IYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAE
RAVTGYRDPYTEQTISLFQAMKKDLIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQ
RGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDSTGQLLLPLSDAHKLTF
RGLRKQITVEELVRSQVMDEATALQLREGLTSIEEVTKNLQKFLEGTSCIAGVFVDATKE
RLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLL
SAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEV
AYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLLIDHQT
YLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAGTL
SITEFADMLSGNASGFRSRSSSVGSSSSYPISPAVSRPQLASWSDPTEETGPVAGILDTE
TLEKVSITEAMHRSLVDNITGQRLLEAQACTGGIIDPSTGERFPVTDAVNKGLVDKIMVD
RINLAQKAFCGFEDPRTKTKMSAAQALRKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVS
LDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAA
AQSSKGYYSPYSVSGSGSTAGSRAGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSGYG
RRYASGSSASLGGPESAVA
Download sequence
Identical sequences F7H3U5
ENSCJAP00000039988 ENSCJAP00000039989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]