SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039991 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039991
Domain Number 1 Region: 5-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.99e-85
Family Calponin-homology domain, CH-domain 0.00000128
Further Details:      
 
Domain Number 2 Region: 1428-1652
Classification Level Classification E-value
Superfamily Plakin repeat 4.19e-52
Family Plakin repeat 0.00015
Further Details:      
 
Domain Number 3 Region: 1656-1834
Classification Level Classification E-value
Superfamily Plakin repeat 3.79e-49
Family Plakin repeat 0.00031
Further Details:      
 
Domain Number 4 Region: 2253-2483
Classification Level Classification E-value
Superfamily Plakin repeat 9.16e-48
Family Plakin repeat 0.00011
Further Details:      
 
Domain Number 5 Region: 6130-6288
Classification Level Classification E-value
Superfamily Spectrin repeat 4.56e-31
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 5145-5305
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-29
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 7 Region: 6568-6718
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-27
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 8 Region: 5256-5406
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-25
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 9 Region: 244-360
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-24
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 10 Region: 4710-4867
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-22
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 11 Region: 6371-6509
Classification Level Classification E-value
Superfamily Spectrin repeat 6.6e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 12 Region: 6721-6837
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-22
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 13 Region: 5703-5848
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-20
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 14 Region: 7060-7139
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.53e-20
Family GAS2 domain 0.00055
Further Details:      
 
Domain Number 15 Region: 6030-6144
Classification Level Classification E-value
Superfamily Spectrin repeat 6.07e-19
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 16 Region: 2566-2657
Classification Level Classification E-value
Superfamily Plakin repeat 1.7e-18
Family Plakin repeat 0.0016
Further Details:      
 
Domain Number 17 Region: 5473-5629
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-18
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 18 Region: 5365-5509
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-18
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 19 Region: 6795-6913,6941-6964
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-18
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 20 Region: 2458-2563
Classification Level Classification E-value
Superfamily Plakin repeat 2.46e-16
Family Plakin repeat 0.0043
Further Details:      
 
Domain Number 21 Region: 3815-3954
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-16
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 22 Region: 6971-7051
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000013
Family Polcalcin 0.057
Further Details:      
 
Domain Number 23 Region: 6292-6403
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000366
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 24 Region: 4924-5084
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000601
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 25 Region: 1154-1282,1309-1335
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000735
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 26 Region: 4377-4500
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000166
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 27 Region: 3680-3802
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000322
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 28 Region: 4595-4721
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000684
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 29 Region: 616-718
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000275
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 30 Region: 4144-4246
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000654
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 31 Region: 3928-4067
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000275
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 32 Region: 5629-5741
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000417
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 33 Region: 4285-4389
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000072
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 34 Region: 5846-5956
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000763
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 35 Region: 5929-6043
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000863
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 36 Region: 3467-3576
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000537
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 37 Region: 525-615
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000034
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 38 Region: 4509-4610
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000202
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 39 Region: 684-801
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000544
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 40 Region: 2206-2272
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000262
Family Plakin repeat 0.0025
Further Details:      
 
Domain Number 41 Region: 1357-1457
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000907
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000039991
Domain Number - Region: 4074-4180
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00036
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number - Region: 5059-5137
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00906
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039991   Gene: ENSCJAG00000002323   Transcript: ENSCJAT00000042248
Sequence length 7360
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:73657261:73908965:1 gene:ENSCJAG00000002323 transcript:ENSCJAT00000042248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLDRYKRDERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLSGIKLPR
EKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIY
ISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERV
QIQSNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEG
ISATEVDSRWQEYQSRVDSLIPWIKQHTILMSDKSFPQNPVELKALYNQYIHFKETEILA
KEREKGRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLRPAVERL
ELLLQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQECEGLIRQ
LQVDLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPPSTLTTI
HLKAEPLTKATHSSSTSWFRKPMTRAELVAISSSEDEGNLRFVYELLSWVEEMQMKLERA
EWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNFRTSYAETLGKLETQYC
KLKETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNPNISAKRNYFSELT
MELEEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHMKENT
AYFQFFSDARELESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIHSKSSVA
SLVGRSKTIVQLKPRSPDHVLKSTISVKAICDYRQIEITICKNDECVLEDNSQRTKWKVI
SPTGNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALWHQLHVNTKSLISWNYLRKD
LDLIQTWNLEKVNTCEQLLKVMSSGMEEKMQDSRDSVLFSVADRLRLEEEVEACKARFQH
LMKSMENEDKEETVAKMYISELKNIRLRLEEYEQRVIKRIQSLASSRTDKDAREDNALRI
AEQEHTQEDLQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVEKMDHVYGLSTV
YLNKLKTIDVIVRSIQDAELLVKGYEIKLSQEEAVPADLSALEAHRSTLRHWLSDVKDKN
SVFSVLDEEIAKAKAVVEQMSRLTSERNLDLERYQEKGSQLQERWHRVIAQLEIRQSELE
GIQEVLGDYRTCHGTLIKWIEATTTQQEMMKPGQAEDSRVLSEQLSQQTDLFAEIERNQT
KLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDAITQEFMDLRTR
YTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQAHVEKVKELLGWVSSLIKESTDIEKA
ILEQQVLAEELTTKREQVSEAIKTSQIFLAKHGHKLSEKEKEQISDQLNALNKTYHDLCD
GSANQLQQLQSQLAHQTEQKDCRAVAGVIDLGTVEIFPIFKAMQKGLLDQDTGRVLLESQ
VIMSGLIAPETSENLSLKEGLARNLINPQMYQQLRELQDALSLISRLTESQGPLSVVEAI
EKRIISERIGLKILEAHLATGGFSLSPSENCVNLEEAFHQGLISAWLHSVLESHLRTSKN
LIDPNTAEKIGLLDLMQRCIVHQESGFKLLPVKQLAGGMVSLKSGRKVSIFRAVQEGLID
RQVTIRLLEAQLFAGGIVDPRTGHRLTVEEAVRHNLIDQDMACATLIRQLQTGGIIDTVT
GQRLTIDEAVSNDLVAAKIALVILESLWSFMGLLWPESGEILPITDALEQGMVSTELAHK
ILSNRQHIKALFLPATTEILSWKKAIESGILDRDLANNLKLICIPDVMPNMQLADSAERN
INPGAAVLPCDKSQSKGISSQSENLLLQLMTHSYINVQNGQRLLLLDEELMETLTSRDEY
QTSLPKVDEIGHQRQNTPEGLRESANVKISGTFGDGWTVRLPEFQFSSQIKEYPSQEYCT
TEEGKKTTVETEGSSVENPELDLFVGEQKERNTNVDALKVINKVKLEVQRQLIGAKREDQ
TAVSVRENVSRGPLLTVPPEEAEGVLLVVDKDLFSVETPKKEHQHQPLRNTSFIYQNEQA
HSLETEYIHDETGGSHIKPQSKKPQVQVKKTLGIKLELKSETDVSVHPLDKKKMLKKTFS
ARDDHKQSLEAQNIAGGSVMMLEKTDEEDSGRETSLSHSHPSELLEEATLNVLSAQLLDG
GIFHEQTGQKLLLNEAVAQGIVPSHTAVKLMEKTCESLTTEEVIDEGLMDEKLLHNVLMA
DKAISGILDPRTHTLYSVKDAVTLGLLDKETATRILERQVATGGIIDLKRGKKVSVTLAS
TLGLVDIGDQPELINLEKASKGRDAEKTVRERLLSLQMETTGLIDPDSKAPLTVVQSIDR
GLLEREEAIRLLSKQVVDGGIIHHISGMRLSVDNAFRHGLIGEDLAKNLKKVENLKIHQF
FNPGTKETVSLPKAIKSDLITPDLKSEIQDIQAFTGNFVDLISGQRLTLEEAEKEGLLAY
EEVLSPGMMHGIIDPENCRIVPYSELVKKCKIDIESGQRYLEIIPFSGIKDGVSNKLLTL
SEAIQLGKVDFASTLKVLEAQANTGGIIDAATGKRLTLASALEEKLVDENMVRIIASHQV
LNGGIVDIFSDQRVTLEKDLLIACNQTAEMSCNKGEESERLLQIENHSAQEKVKVRVSDG
EQAKESREISLQEFGCKDQHKPRMSPDVKEFISIINPHNLEGKSLGRVSLTHPYSEVGDF
KLEEVSRNNMGKDTNEEQEKAVTQIEIISHMKKSTSCLDSEEIRENQGEVILEVAESYCE
TSGKLPSEQVLQQPVNTRVKNREKREVTVEEKLYQETAIRDEHDSHIKSQPREMTSSEKQ
KEADTEMGFSVTFSTEDSSAQVAPKGISVKHQDAVTLFSSKQAGEGKVNNISVCLTLKPE
ENLSEEIACGAQSEPFPSMTPRPEGLHYQESDGKAQVTDASQISKTDKSFQGTTRQETTY
HQDSYATSKTKETKHLISSSNECKEKSSQEVSFDSVRGLKLEEITVSRADSKEVSYLEFS
DRKGLHYQGSKSNDKLCGTLKSETATQEITGEKFLERANPKVTGPEAGSVEDIVTQRGSR
VLASFLPEKLLKDGSQKENSGQQNATISPTVPETSDEKTVSLTVCSTMKTEKIPQEKLRE
SAGNEQTPFITAHGEKGNGDSPQNVFTRQLCLEHDEKLVSYLSLLRDIEMRTKQIQPLEL
NLAELQNLLCQAKLLDRELKDLTTLISQELECVNQIIISRPQEVPAQLLKALEKDAKNLQ
KSLSSVSDTWNSRLLHFQNAVEVEKTKVLNQHTQLEGRLQDLRAWVGNTNLILNSKGSNS
ETDVDSLNCCLQQYEVFKLSYLKDLKQPMAERKSQLDALAFDVQFFISEHAQDLSLQQNR
QMLRLLNELQKSFQDILEQTAAQADALQGHLQQMEQEVLVKKQRNTCHQKLEDLCSWVGQ
AERALAGHQGRTTQQDLSALQKNQSDLKDLQDDIQNHVTSFATVVKDIEGFMEENQTKLS
PYELTALREKLHQAKEQYEALQEQTRVAQKELEEAVTSVLQQETEKSKAAKELAENKKKI
DALLEWVTSVGSSDGQLLTNLPGMEQFSGASLEKGALDTTDGYMGVNQAPEKLDKQCEKM
KARHRELLSQQQNFILATQSAQAFLDQHGYNLTPEEQQMLQEKLGELKEQYSTSLTQSEA
ELKRMQTLQDELQKFLQDHREFESWLERSEKELENMHKGGSSPKALPSLLKRQGSFSEDV
ISHKGDLRFVTISGQKVLDTENSFKEGKEPSEIGNLVRDKLQDATERYTALHSKCTRLGS
HLNMLLGQYHQFQNSADSLQAWMQTCEANVEKLLSDTVASDPGVLQEQLATTKNKQQLQE
ELAEHQVPVEKLQKVARDIMEIEGEPAPDHKHVQETTDSIFSHFQSLSYSLAERSALLQK
AIAQSQSVQESLETLLQSIGEVEQNLEGNQVASLSSGVIQEALATNMKLKQDIARQKSSL
EATREMVTRFMETADGTTAAVLQGKLAEVSQRFEQLCLQQQEKESSLKKLLPQAEMFEHL
SDKLQQFMENKSRMLASGNQPDQDIAHFFQQIQELSLEMEDQQENLDTLEHLVTELSSCG
FALDLSQHQDRVQNLRKDFTELQKTVKEREKDASSCQEQLDEFRKLVRTFQKWLKETEGS
IPPTETSMSAKELEKQIEYLKSLLDDWASKGTLVEEINCKGTSLENLIMEITAPDSQGKT
AKSNSSILPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNLKYEKLGGVLHESQESLQAVLN
KMEEVQKEANSVLQWLESKEKVLKSMDAMSSPTKTETVKAQAESNKAFLAELEQNSPKIQ
KVKEALAGLLVTYPNSQEAENWKKIQEELNYRWERATELTVARQRQLEESASHLAYFQAA
ESQLRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLNEAAQGIL
MGPGDVSLSTSQVQKELQSINQKWVELTDKLNSRSSQIDQAIVKSTQYQELLQDLSEKVK
TVGQRLSGQSAISTQPEAVKQQLEETSEIRSDLEQLDQEVKEAQTLCDELSVLIGEQYLK
DELKKRLETVALPLQGLEDLAADRMNRLQAALASTQQFQQMFDELRTWLDDKQSQQTKNC
PISAKLERLQSQLQENEEFQKSLNQHSGSYEVIVAEGESLLLSVPPGEEKRTLQNQLVEL
KNHWEELSKKTADRQSRLKDCMQKAQKYQWHVEDLVPWVEDCKAKMSELRVTLDPVQLES
SLLRSKAMLSEVEKRRSLLEILNSAADILINSSEADEDGIRDEKAGINQNMDAITEELQA
KTGSLEEMTQRLKEFQESFKNIEKKVEGAKHQLEIFDALGSQACSNKNLEKLRAQQEVLQ
ALEPQVDYLRNFTQGLVEDAPDGSDASQLLHQAEVAQQEFLEVKQRVNSGCVMMENKLEG
IGQFHCRVREMFSQLADLDDELDGMGAVGRDTDSLQSQIEDVRLFLNKIQVLKLDIEASE
VECRHMLEEEGTLDLLGLKRELEALNKQCGKLTERGKARQEQLELTLGRVEEFYRKLKGL
NDATTGAEEAEALQWVVGTEVEIINQQLADFKMFQKEQVDPLQMKLQQVNGLGQGLIQSA
GKDCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLADTEE
LIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAEVADREKITG
QLESLESRWTELLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQ
TAKIQQQIIRHKALEEDIENHATDVHQAVKIGQSLSSLTSAEQGVLSEKIDSLQARYREI
QDRCCRKAALLDQALANARLFGEDEVEVLNWLAEVEDKLSSVFVKDFKQDVLHKQHADHL
ALNEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTL
EQARQLATKFQSTYEELTGWLREVEGELAANGGQSPTGEQIPQFQQRQKELKKEVMEHRL
VLDTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVSDTIGQRVDEIDAAIQRSQQYE
QAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRGE
IFGTCGEEQKAVLQEKTESLIEQYEAISLLNSDRYARLERAQVLVNQFWETYEELSPWIE
ETRTLIAQLPPPAIDHEQLRHQQEEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEGKM
VEEKYQNAENMYAQIKEEVRQRALALDEAVSQSAQFHDKIEPMLETLENLSSRLRMPPLI
PAEVDKIRECISENKSATVELEKLQPSFEALKHRGEELIGRSQGADKDLAAKEIQDKLDQ
MVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPSII
KQQVEAAETIKEETDGLHEELEFIRILGADLIFACGETEKPEVRKSIDEMNNAWENLNKT
WKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFK
VEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLEG
ALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATV
ETVNKAGNELLESSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQKAQGFHS
EIEDFLLELTRMESQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLM
LLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFINWLT
LAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDVV
LIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELE
ISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLSEDTQKLDNFLGEVR
DKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMN
LMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSVS
KQSRLEQALKQAEEFRDTVHMLLEWLSEAEQTLRFRGALPDDTEALQTLIDTHKEFMKKV
EEKRVDVNSAVAMGEILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSEL
VANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVDRV
TKTYKRKNIEPTHAPFIEKSRSGGSMFPAPVPTPPPMPILSQSEAKNPRINQLSARWQQL
KEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKL
EMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQ
VEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHPG
SKIKRSDSSSSISSQSPIVLARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAA
SPTRSSSSASQSNHSCTSMPSSPATPASGTKKFIPSSGSKLKRPTPTFHSSRTSLAGDTS
NSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTS
ESSAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences F7GYW5
ENSCJAP00000039991 ENSCJAP00000039991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]