SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040020 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040020
Domain Number 1 Region: 170-494
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.81e-77
Family Pancreatic carboxypeptidases 0.00000175
Further Details:      
 
Domain Number 2 Region: 31-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.62e-31
Family Frizzled cysteine-rich domain 0.00066
Further Details:      
 
Domain Number 3 Region: 494-573
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 4.12e-18
Family Carboxypeptidase regulatory domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040020   Gene: ENSCJAG00000021495   Transcript: ENSCJAT00000042278
Sequence length 643
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:186615235:186648135:1 gene:ENSCJAG00000021495 transcript:ENSCJAT00000042278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPPPLLLLAVLVAAAARPGCEFDGSLAATCVDLQLRTCSDAAYNHTTFPTPLQHRSRE
AVEASSEYILLSVLHQLLEGQCNPDLRLLGCAVLAPRCEGGRVRRPCRHVCEGLREACQP
AFDAIDMAWPYFLDCHRYFKREDEGCYDPLEKLRGGLEADEVLPSGLPPTFIRFSHHSYA
QMARVLRRTAARCAHVARTYSIGRSFDGRDLLVIEFSSRPGQHELMEPEVKLIGNIHGNE
VAGREMLIYLTQYLCSEYLLGNPRIQRLLNTTRIHLLPSMNPDGYEVAAAEGAGYNGWTS
GRQNAQNLDLNRNFPDLTSEYYRLAGTRSVRSDHIPIPEHYWWGKVAPETKAIMKWMQTI
PFVLSASLHGGDLVVSYPFDFSKQPQEEKMFSPTPDEKTFKLLSRAYAEVHPMMMDRSEN
RCGGNFLKRGSIINGADWYSFTGGMSDFNYLHTNCFEITVELGCVKFPPEEALYTIWQHN
KESLLNFVETVHRGIKGVVMDKYGKPVKNARILVKGIRHDITTAPDGDYWRLLPPGTHIV
IAQAPGYARLIKKVIIPARMKRAGRVDFILQPLGVGPKNFLPGLRRTGPHDPLGGASPLG
EGTEPNPDPLRARRQPSAGGSKPWWWSYFTSLSAHRPRWLLKY
Download sequence
Identical sequences F7ILN0
ENSCJAP00000040021 ENSCJAP00000040020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]