SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040038 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040038
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.23e-127
Family Transglutaminase core 0.0000000000105
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 4.2e-42
Family Transglutaminase N-terminal domain 0.000000572
Further Details:      
 
Domain Number 3 Region: 470-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.11e-35
Family Transglutaminase, two C-terminal domains 0.000000981
Further Details:      
 
Domain Number 4 Region: 586-686
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.88e-27
Family Transglutaminase, two C-terminal domains 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040038   Gene: ENSCJAG00000021503   Transcript: ENSCJAT00000042296
Sequence length 687
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:32149018:32187803:-1 gene:ENSCJAG00000021503 transcript:ENSCJAT00000042296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEELILERCDLELESNGRDHHTADLCQEKLVVRRGQPFRLTLHFEGRNYEASVDSLTFS
VVTGPAPSKEAGTKARFPLQDAVEEGGWTAAVVDQQDCALSLQLTAPADAPIGLYRLSLE
AATGYQGSSFVLGHFTLLFNAWCPVDAVYLDSEEERQEYILTQQGFIYQGSAKFIKSVPW
NFGQFEDGILDICLMLLDVNPKFVKDAGRDCSRRSSPIYIGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMFWIGSVDILRRWRNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSMHKSVNRSL
VVGMKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEEAGMAMRIRVG
QSMNMGSDFDVFAHITNNTTEEHACRLLLCARTVSYNGVLGPECGTKDLLNLTLEPFSEK
SIPLRILYEKYCDCLTESNLIKVRGLLVEPATNSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLRNPLTVSLAGCIFTVEGAGLTEEQKTVEIQDPVEAGEEVKVRVDLLPLHVG
RHKLVVNFESDKLKAVKGFRNVIIGPA
Download sequence
Identical sequences F7ILK8
ENSCJAP00000040038 XP_002747597.3.60252 ENSCJAP00000040037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]