SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040374 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040374
Domain Number 1 Region: 34-171
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-17
Family C-type lectin domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040374   Gene: ENSCJAG00000034487   Transcript: ENSCJAT00000042642
Sequence length 180
Comment pep:novel chromosome:C_jacchus3.2.1:9:11212307:11219227:-1 gene:ENSCJAG00000034487 transcript:ENSCJAT00000042642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMQQNYLQVENENLSGILQQLAKHFCYIDQPLLIPILIKPQGTFKDHKCSPCDTNWRYYG
GRCYGFFKHNLMWEDKQYCIDMNSTLLKTDNKNIPLRYIVDHIVSVRFFGLSHQNSNEVW
KWEMAQFSQKNRKFELSEDGKENMNRAYFHNGRMHPTFCKSKHYLMCERKTGMANMGQLP
Download sequence
Identical sequences F7IR50
ENSCJAP00000040374 ENSCJAP00000040374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]