SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040562 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040562
Domain Number 1 Region: 8-124
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 6.32e-34
Family Ribosomal proteins L24p and L21e 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040562   Gene: ENSCJAG00000021870   Transcript: ENSCJAT00000042855
Sequence length 145
Comment pep:novel chromosome:C_jacchus3.2.1:3:140732610:140733112:1 gene:ENSCJAG00000021870 transcript:ENSCJAT00000042855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFNPFVTSDRSKNRKRHFKAPSHIRRKIMSSPLSKELRQKYNVRSMPIRNDDEVQVVQG
HHKGQQIGKVVQVYRKKYIIYIERVQREKANGTTVHVGIHPSKAVITRLKLDKDRKKILE
RKAKSCQVGKEKGKYKEETIEKMQE
Download sequence
Identical sequences F7IQW8
ENSCJAP00000040562 XP_002745895.1.60252 ENSCJAP00000040562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]