SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040692 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040692
Domain Number 1 Region: 17-72
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000371
Family Ribosomal protein L3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040692   Gene: ENSCJAG00000022022   Transcript: ENSCJAT00000043007
Sequence length 100
Comment pep:novel chromosome:C_jacchus3.2.1:1:149430860:149431162:-1 gene:ENSCJAG00000022022 transcript:ENSCJAT00000043007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNNASTDYDLTKASTLWVHYGQVPSDCVMLKGCVVGTKKQVLTFRKSLLVQTKQEALEKT
DLKFTDTTSKFGHGRFQTIEEKRAFMGPLKKDRIAKEEGA
Download sequence
Identical sequences F7I4M7
ENSCJAP00000040692 ENSCJAP00000040692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]