SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040744 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040744
Domain Number 1 Region: 3-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-78
Family G proteins 0.0000000126
Further Details:      
 
Domain Number 2 Region: 338-441
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 4.53e-45
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000031
Further Details:      
 
Domain Number 3 Region: 238-334
Classification Level Classification E-value
Superfamily Translation proteins 2.21e-30
Family Elongation factors 0.00000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040744   Gene: ENSCJAG00000022080   Transcript: ENSCJAT00000043065
Sequence length 462
Comment pep:novel chromosome:C_jacchus3.2.1:11:54132966:54134354:-1 gene:ENSCJAG00000022080 transcript:ENSCJAT00000043065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGDIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKYGQTRKHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTHKDGNASGTTLLEALDCILPPTR
PTDKPLRLPLQDVFKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRHSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKPK
Download sequence
Identical sequences F7HQ79
ENSCJAP00000040744 ENSCJAP00000040744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]