SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041103 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000041103
Domain Number 1 Region: 32-143
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.02e-42
Family Frizzled cysteine-rich domain 0.000000805
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000041103
Domain Number - Region: 221-527
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0549
Family Rhodopsin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041103   Gene: ENSCJAG00000022490   Transcript: ENSCJAT00000043475
Sequence length 585
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:123731350:123734718:-1 gene:ENSCJAG00000022490 transcript:ENSCJAT00000043475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPDPSAPPSLLLLLLAQLAGRATAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRAFPAKPTLPGPPGAPASGG
ECPAGGPSVCKCRDPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSSDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HRAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPAPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAAAYHKQVSLSHV
Download sequence
Identical sequences F7DXM6
ENSCJAP00000041103 ENSCJAP00000041103 XP_002749755.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]