SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041244 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000041244
Domain Number 1 Region: 5-375
Classification Level Classification E-value
Superfamily Translation proteins 8.65e-109
Family Ribosomal protein L3 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041244   Gene: ENSCJAG00000022645   Transcript: ENSCJAT00000043630
Sequence length 403
Comment pep:novel scaffold:C_jacchus3.2.1:ACFV01179142.1:4807:6707:1 gene:ENSCJAG00000022645 transcript:ENSCJAT00000043630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNNTDFTAPRHGSLGFLPQKRNSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREV
DRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYK
NWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLPLRQKKAHL
MEIQVNGGTVSEKLDWARKRLEQQVPVNQVFGQDEMIDVIGVSKRKGYKGVTSRWHTKKL
PRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIK
NNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKWWAL
EKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKNRIAKEEGA
Download sequence
Identical sequences H9KXT3
ENSCJAP00000041244 ENSCJAP00000041244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]