SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041334 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000041334
Domain Number 1 Region: 7-103
Classification Level Classification E-value
Superfamily Histone-fold 1.87e-25
Family Nucleosome core histones 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041334   Gene: ENSCJAG00000022741   Transcript: ENSCJAT00000043726
Sequence length 116
Comment pep:novel chromosome:C_jacchus3.2.1:X:83726738:83727088:-1 gene:ENSCJAG00000022741 transcript:ENSCJAT00000043726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERRSRRGSSAAGRRGHTRSRTARAELIFSVSQMERGLWEGHYAQRLSDNAPIYLAAVI
QYLTAKILELAAEEADNNGGERIITPRLLDLVIRNDGLLSTLFRNILISQVAPGPN
Download sequence
Identical sequences F7FFR8
ENSCJAP00000041334 XP_002763113.1.60252 ENSCJAP00000041334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]