SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041388 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000041388
Domain Number 1 Region: 32-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.05e-44
Family Frizzled cysteine-rich domain 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041388   Gene: ENSCJAG00000022807   Transcript: ENSCJAT00000043792
Sequence length 581
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:121190000:121191816:1 gene:ENSCJAG00000022807 transcript:ENSCJAT00000043792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRPGPQLWLVLQVLGACAAISSMDMERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPARGPGLFPPLFRPQRPHGAQEH
PLKDGTPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAVWTVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHK
CKMNNQTKTPDCLMAASIPAVEIFMVKIFMLLVVGITSGVWIWTSKTLQSWQQVCSRRLK
KKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQPPTCV
Download sequence
Identical sequences F7EAW1
ENSCJAP00000041388 ENSCJAP00000041388 XP_002753203.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]