SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042189 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042189
Domain Number 1 Region: 30-99
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000553
Family BphP N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042189   Gene: ENSCJAG00000003903   Transcript: ENSCJAT00000052763
Sequence length 227
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:138560008:138585718:1 gene:ENSCJAG00000003903 transcript:ENSCJAT00000052763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDKVNPESSQKKSFDTYDDSNQMMLQSLDGFMITLSTDGVIIYVDENISPLLGHMPSATV
DKKLLSLLPDAEKNKVSEKIILKFPLFNSETHIEFCCHLKRGNVEHGDGPAYEYVKFILN
VKHICNESAVFFSSFCSSRRYAALSAKHITWEDQFYLMGIVCVLRTQLLKRLYTRSKVTD
KFILTQESDEESFVKDLSGSQDEGGHTSMEVVCAEPAAAAAAAATLD
Download sequence
Identical sequences F6ULP7
ENSCJAP00000042189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]