SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042324 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042324
Domain Number 1 Region: 83-158
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.57e-28
Family Skp1 dimerisation domain-like 0.0000114
Further Details:      
 
Domain Number 2 Region: 2-68
Classification Level Classification E-value
Superfamily POZ domain 2.25e-25
Family BTB/POZ domain 0.0000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042324   Gene: ENSCJAG00000022954   Transcript: ENSCJAT00000043939
Sequence length 161
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:43131632:43132117:1 gene:ENSCJAG00000022954 transcript:ENSCJAT00000043939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAVLKKVIQWC
THHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFGLILAANYLDIKGLLDVTCET
VANMIKGKTPEEICKTSNIKIDFTEEEEAQVRKENQWCEEK
Download sequence
Identical sequences F6WC44
ENSCJAP00000042324 ENSCJAP00000042324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]