SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042507 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042507
Domain Number 1 Region: 251-548
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.32e-84
Family Pancreatic carboxypeptidases 0.0000000017
Further Details:      
 
Domain Number 2 Region: 2-136
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.5e-27
Family Pancreatic carboxypeptidases 0.0000215
Further Details:      
 
Domain Number 3 Region: 548-628
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.71e-19
Family Carboxypeptidase regulatory domain 0.0000311
Further Details:      
 
Domain Number 4 Region: 136-222
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.55e-17
Family Carboxypeptidase regulatory domain 0.00082
Further Details:      
 
Domain Number 5 Region: 680-755
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-16
Family Pancreatic carboxypeptidases 0.01
Further Details:      
 
Domain Number 6 Region: 746-835
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000235
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042507   Gene: ENSCJAG00000013845   Transcript: ENSCJAT00000060701
Sequence length 903
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:93603265:93676566:-1 gene:ENSCJAG00000013845 transcript:ENSCJAT00000060701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFVLSGNLHGGSVVASYPFDDSPEHKATGFYSKTSDDEVFKYLAKAYASNHPIMKTGEP
HCPGDEDESFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQLRQEWE
NNRESLITLIEKVHIGVKGFVKDSVTGSGLENATISVAGINHNITTGRFGDFHRLLVPGT
YNLTVVLTGYMPLTVTNIVVKEGPATEVDFSLRPSVTSVIPDTTEAIATASTVAIPNIPS
GTLSSYQPIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYVMEISDNP
GVHEPGEPEFKYIGNMHGNEVVGKELLLNLIEYLCKNFGTDPEVTDLVRSTRIHLMPSMN
PDGYEKSQEGDSISVIGRNNSNNFDLNRNFPDQFVHITDPTQPETIAVMSWMKSYPFVLS
ANLHGGSLVVNYPFDDDERGVATYSKSPDDAVFQQIALSYSKENSQMFQGRPCKNMYPNE
YFPHGITNGANWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPFEKELPNFWEQNRRSLIQ
FMKQVHQGVKGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTYKITASAR
GYNPVTKNVTVKSEGATQVNFTLVRSSTDSNNESKKGKGASTSTDDASDPTTKEFETLIK
DLSAENGLESLMLPSSSNLALYRYHSYKDLSEFLRGLVMNYPHITNLTNLGQSAEYRHIW
SLEISNKPNVSEPEEPKIRFVAGIHGNAPVSKAVIVLNEGIKVHIKEGGYFHVLLAPGVH
NINAIADGYQQQHSQVFVHHDAASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTAC
IIWCICSIKSNRHKDGFHRLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYS
SKH
Download sequence
Identical sequences F6XHA5
ENSCJAP00000042507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]