SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042521 from Callithrix jacchus 76_3.2.1

(show help)
Strong hits

Sequence:	ENSCJAP00000042521
Domain Number 1	Region: 228-285
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	4.2e-25
Family	Classic zinc finger, C2H2	0.0058
Further Details:

Domain Number 2	Region: 172-229
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	2.72e-20
Family	Classic zinc finger, C2H2	0.0047
Further Details:

Domain Number 3	Region: 1-54
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	1.44e-17
Family	KRAB domain (Kruppel-associated box)	0.0013
Further Details:

Domain Number 4	Region: 134-186
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.000000000323
Family	Classic zinc finger, C2H2	0.006
Further Details:

Domain Number 5	Region: 89-145
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.00000822
Family	Classic zinc finger, C2H2	0.043
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSCJAP00000042521 Gene: ENSCJAG00000011900 Transcript: ENSCJAT00000058373
Sequence length	292
Comment	pep:known_by_projection chromosome:C_jacchus3.2.1:13:50674:54156:1 gene:ENSCJAG00000011900 transcript:ENSCJAT00000058373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MTFEDIIIDFTREEWALLDTSQRKLFRDVMLENISHLVSIAICFLFTYIVISLECTEVFK HHKVLTTSQIALHWDTTTEKLYMHMDKYFNSLSFPSQNQRSHTQDDPFLCNDLGEDFTQH IPLTQNMVTYMSKKQFVSKMFRKTFSNQLSFNQHKQIYTRYKPYGCHLCGKAFSKCSYLR QHERIHNGEKPYECHLCGKAFSHCSHLRQHERSHNGEKPHGCHLCGKAFTESSVLKRHER THTGEKPYECHICGKAFTESSDLRRHERTHTGEKPYQCHLCGKAFNHSSVLR
Download sequence
Identical sequences	F6WUS3 ENSCJAP00000042521

SEARCH