SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042659 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042659
Domain Number 1 Region: 137-339
Classification Level Classification E-value
Superfamily Caspase-like 4.64e-50
Family Caspase catalytic domain 0.00023
Further Details:      
 
Domain Number 2 Region: 1-98
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-20
Family DEATH effector domain, DED 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042659   Gene: ENSCJAG00000004505   Transcript: ENSCJAT00000054974
Sequence length 366
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:116629829:116670823:1 gene:ENSCJAG00000004505 transcript:ENSCJAT00000054974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEIGENLDKSDVSSLIFLMRDYMGRGKINKEKSFLDLVVELEKRNLVAPDQLDLLEKCL
KNIHRLDLKTKIQKYKQSAQGAGTSYKNVLQAAIKNSFKDPSNNFRLHNGRSKEQRLKEQ
LGTQQEPVKTSIQESEAFLPQSMPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGY
EVQKSLHLTMDGILQVLQRVACMPQHQDYDSFVCVLVSRGGSQTVYGVDQTHPGLPLHHI
RRMFMGDLCPYLVGKPKVFFIQNYMVSEGQLEDSSLLEVDGPAMKNVESKSQQRGPCTVH
READFFWSLCTADVSLLEESCGSPSLYLQCLSQKLRQESRTIPGSEITESKDMHFSSLGG
ILPDVL
Download sequence
Identical sequences F6ZNZ2
ENSCJAP00000042659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]