SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042893 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042893
Domain Number 1 Region: 174-352
Classification Level Classification E-value
Superfamily Plakin repeat 3.01e-49
Family Plakin repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 1-170
Classification Level Classification E-value
Superfamily Plakin repeat 2.49e-42
Family Plakin repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 804-984
Classification Level Classification E-value
Superfamily Plakin repeat 6.8e-40
Family Plakin repeat 0.00022
Further Details:      
 
Domain Number 4 Region: 5154-5312
Classification Level Classification E-value
Superfamily Spectrin repeat 3.77e-29
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 4717-4867
Classification Level Classification E-value
Superfamily Spectrin repeat 5.65e-29
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 3729-3889
Classification Level Classification E-value
Superfamily Spectrin repeat 6.86e-29
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 7 Region: 707-843
Classification Level Classification E-value
Superfamily Plakin repeat 1.44e-25
Family Plakin repeat 0.00068
Further Details:      
 
Domain Number 8 Region: 3840-3988
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-25
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 9 Region: 1095-1202
Classification Level Classification E-value
Superfamily Plakin repeat 7.19e-24
Family Plakin repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 3294-3451
Classification Level Classification E-value
Superfamily Spectrin repeat 2.5e-22
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 11 Region: 5307-5423
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-22
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 12 Region: 4957-5095
Classification Level Classification E-value
Superfamily Spectrin repeat 5.64e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 13 Region: 4275-4432
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-21
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 14 Region: 5666-5748
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.54e-21
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 15 Region: 2406-2542
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-19
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 16 Region: 4617-4731
Classification Level Classification E-value
Superfamily Spectrin repeat 4.87e-19
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 17 Region: 3949-4093
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-18
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 18 Region: 5381-5499,5526-5557
Classification Level Classification E-value
Superfamily Spectrin repeat 2.2e-18
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 19 Region: 4059-4213
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-18
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 20 Region: 988-1092
Classification Level Classification E-value
Superfamily Plakin repeat 1.75e-16
Family Plakin repeat 0.0043
Further Details:      
 
Domain Number 21 Region: 4840-4947
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-16
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 22 Region: 5577-5657
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000001
Family Polcalcin 0.057
Further Details:      
 
Domain Number 23 Region: 3508-3668
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000407
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 24 Region: 3185-3305
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000535
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 25 Region: 2961-3084
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000111
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 26 Region: 2272-2393
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000254
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 27 Region: 2731-2834
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000393
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 28 Region: 2516-2645
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000547
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 29 Region: 2869-2973
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000768
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 30 Region: 4516-4619
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000308
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 31 Region: 4437-4543
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000504
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 32 Region: 2050-2167
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000445
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 33 Region: 2609-2728
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000183
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 34 Region: 3093-3212
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000113
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 35 Region: 1883-2036
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000256
Family Spectrin repeat 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000042893
Domain Number - Region: 3643-3721
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00446
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042893   Gene: ENSCJAG00000002323   Transcript: ENSCJAT00000055100
Sequence length 5940
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:73757755:73910304:1 gene:ENSCJAG00000002323 transcript:ENSCJAT00000055100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGLLDQDTGRVLLESQVIMSGLIAPETSENLSLKEGLARNLINPQMYQQLRELQDALS
LISRLTESQGPLSVVEAIEKRIISERIGLKILEAHLATGGFSLSPSENCVNLEEAFHQGL
ISAWLHSVLESHLRTSKNLIDPNTAEKIGLLDLMQRCIVHQESGFKLLPVKQLAGGMVSL
KSGRKVSIFRAVQEGLIDRQVTIRLLEAQLFAGGIVDPRTGHRLTVEEAVRHNLIDQDMA
CATLIRQLQTGGIIDTVTGQRLTIDEAVSNDLVAAKIALVILESLWSFMGLLWPESGEIL
PITDALEQGMVSTELAHKILSNRQHIKALFLPATTEILSWKKAIESGILDRDLANNLKLI
CIPDVMPNMQLADSAERNINPGAAVLPCDKSQSKGISSQSENLLLQLMTHSYINVQNGQR
LLLLDEELMETLTSRDEYQTSLPKVDEIGHQRQNTPEGLRESANVKISGTFGDGWTVRLP
EFQFSSQIKEYPSQEYCTTEEGKKTTVETEGSSVENPELDLFVGEQKERNTNVDALKVIN
KVKLEVQRQLIGAKREDQTAVSVRENVSRGPLLTVPPEEAEGVLLVVDKDLFSVETPKKE
HQHQPLRNTSFIYQNEQAHSLETEYIHDETGGSHIKPQSKKPQVQVKKTLGIKLELKSET
DVSVHPLDKKKMLKKTFSARDDHKQSLEAQNIAGGSVMMLEKTDEEDSGRETSLSHSHPS
ELLEEATLNVLSAQLLDGGIFHEQTGQKLLLNEAVAQGIVPSHTAVKLMEKLNMFRGFFD
SQTCESLTTEEVIDEGLMDEKLLHNVLMADKAISGILDPRTHTLYSVKDAVTLGLLDKET
ATRILERQVATGGIIDLKRGKKVSVTLASTLGLVDIGDQPELINLEKASKGRDAEKTVRE
RLLSLQMETTGLIDPDSKAPLTVVQSIDRGLLEREEAIRLLSKQVVDGGIIHHISGMRLS
VDNAFRHGLIGEDLAKNLKKVENLKIHQFFNPGTKETVSLPKAIKSDLITPDLKSEIQDI
QAFTGNFVDLISGQRLTLEEAEKEGLLAYEEVLSPGMMHGIIDPENCRIVPYSELVKKCK
IDIESGQRYLEIIPFSGIKDGVSNKLLTLSEAIQLGKVDFASTLKVLEAQANTGGIIDAA
TGKRLTLASALEEKLVDENMVRIIASHQVLNGGIVDIFSDQRVTLEEATEKRFISPELAN
MLQRDTSEFSDHRAQIEKQEGIEACALQNEFLRKDLLIACNQTAEMSCNKGEESERLLQI
ENHSAQEKVKVRVSDGEQAKESREISLQEFGCKDQHKPRMSPDVKEFISIINPHNLEGKS
LGRVSLTHPYSEVGDFKLEEVSRNNMGKDTNEEQEKAVTQIEIISHMKKSTSCLDSEEIR
ENQGEVILEVAESYCETSGKLPSEQVLQQPVNTRVKNREKREVTVEESIKTYKSAVFSEE
KLYQETAIRDEHDSHIKSQPREMTSSEKQKEADTEMGFSVTFSTEDSSAQVAPKGISVKH
QDAVTLFSSKQAGEGKVNNISVCLTLKPEENLSEEIACGAQSEPFPSMTPRPEGLHYQES
DGKAQVTDASQISKTDKSFQGTTRQETTYHQDSYATSKTKETKHLISSSNECKEKSSQEV
SFDSVRGLKLEEITVSRADSKEVSYLEFSDRKGLHYQGSKSNDKLCGTLKSETATQEITG
EKFLERANPKVTGPEAGSVEDIVTQRGSRVLASFLPEKLLKDGSQKENSGQQNATISPTV
PETSDEKTVSLTVCSTMKTEKIPQEKLRESAGNEQTPFITAHGEKGNGDVNPEPFRAIQN
VFTRQLCLEHDEKLVSYLSLLRDIEMRTKQIQPLELNLAELQNLLCQAKLLDRELKDLTT
LISQELECVNQIIISRPQEVPAQLLKALEKDAKNLQKSLSSVSDTWNSRLLHFQNAVEVE
KTKVLNQHTQLEGRLQDLRAWVGNTNLILNSKGSNSETDVDSLNCCLQQYEDLKQPMAER
KSQLDALAFDVQFFISEHAQDLSLQQNRQMLRLLNELQKSFQDILEQTAAQADALQGHLQ
QMEQEVLVKTLQKQRNTCHQKLEDLCSWVGQAERALAGHQGRTTQQDLSALQKNQSDLKD
LQDDIQNHVTSFATVVKDIEGFMEENQTKLSPYELTALREKLHQAKEQYEALQEQTRVAQ
KELEEAVTSVLQQETEKSKAAKELAENKKKIDALLEWVTSVGSSDGQLLTNLPGMEQFSG
ASLEKGALDTTDGYMGVNQAPEKLDKQCEKMKARHRELLSQQQNFILATQSAQAFLDQHG
YNLTPEEQQMLQEKLGELKEQYSTSLTQSEAELKRMQTLQDELQKFLQDHREFESWLERS
EKELENMHKGGSSPKALPSLLKRQGSFSEDVISHKGDLRFVTISGQKVLDTENSFKEGKE
PSEIGNLVRDKLQDATERYTALHSKCTRLGSHLNMLLGQYHQFQNSADSLQAWMQTCEAN
VEKLLSDTVASDPGVLQEQLATTKQLQEELAEHQVPVEKLQKVARDIMEIEGEPAPDHKH
VQETTDSIFSHFQSLSYSLAERSALLQKAIAQSQSVQESLETLLQSIGEVEQNLEGNQVA
SLSSGVIQEALATNMKLKQDIARQKSSLEATREMVTRFMETADGTTAAVLQGKLAEVSQR
FEQLCLQQQEKESSLKKLLPQAEMFEHLSDKLQQFMENKSRMLASGNQPDQDIAHFFQQI
QELSLEMEDQQENLDTLEHLVTELSSCGFALDLSQHQDRVQNLRKDFTELQKTVKEREKD
ASSCQEQLDEFRKLVRTFQKWLKETEGSIPPTETSMSAKELEKQIEYLKSLLDDWASKGT
LVEEINCKGTSLENLIMEITAPDSQGKTGSILPSVGSSVGSVNGYHTCKDLTEIQCDMSD
VNLKYEKLGGVLHESQESLQAVLNKMEEVQKEANSVLQWLESKEKVLKSMDAMSSPTKTE
TVKAQAESNKAFLAELEQNSPKIQKVKEALAGLLVTYPNSQEAENWKKIQEELNYRWERA
TELTVARQRQLEESASHLAYFQAAESQLRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQ
FMLKEFEARRQQHEQLNEAAQGILMGPGDVSLSTSQVQKELQSINQKWVELTDKLNSRSS
QIDQAIVKSTQYQELLQDLSEKVKTVGQRLSGQSAISTQPEAVKQQLEETSEIRSDLEQL
DQEVKEAQTLCDELSVLIGEQYLKDELKKRLETVALPLQGLEDLAADRMNRLQAALASTQ
QFQQMFDELRTWLDDKQSQQTKNCPISAKLERLQSQLQENEEFQKSLNQHSGSYEVIVAE
GESLLLSVPPGEEKRTLQNQLVELKNHWEELSKKTADRQSRLKDCMQKAQKYQWHVEDLV
PWVEDCKAKMSELRVTLDPVQLESSLLRSKAMLSEVEKRRSLLEILNSAADILINSSEAD
EDGIRDEKAGINQNMDAITEELQAKTGSLEEMTQRLKEFQESFKNIEKKVEGAKHQLEIF
DALGSQACSNKNLEKLRAQQEVLQALEPQVDYLRNFTQGLVEDAPDGSDASQLLHQAEVA
QQEFLEVKQRVNSGCVMMENKLEGIGQFHCRVREMFSQLADLDDELDGMGAVGRDTDSLQ
SQIEDVRLFLNKIQVLKLDIEASEVECRHMLEEEGTLDLLGLKRELEALNKQCGKLTERG
KARQEQLELTLGRVEEFYRKLKGLNDATTGAEEAEALQWVVGTEVEIINQQLADFKMFQK
EQVDPLQMKLQQVNGLGQGLIQSAGKDCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQE
ALLHCGKFQDALEPLLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATV
DMLQAEGGRIAQSAEVADREKITGQLESLESRWTELLSKAAARQKQLEDILVLAKQFHET
AEPISDFLSVTEKKLANSEPVGTQTAKIQQQIIRHKALEEDIENHATDVHQAVKIGQSLS
SLTSAEQGVLSEKIDSLQARYREIQDRCCRKAALLDQALANARLFGEDEVEVLNWLAEVE
DKLSSVFVKDFKQDVLHKQHADHLALNEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQ
EKLDGIKTRYADITVTSSKALRTLEQARQLATKFQSTYEELTGWLREVEGELAANGGQSP
TGEQIPQFQQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREGLDKLVSDANEQYK
LVSDTIGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQV
QKAFSIDIIRHKDSMDELFSHRGEIFGTCGEEQKAVLQEKTESLIEQYEAISLLNSDRYA
RLERAQVLVNQFWETYEELSPWIEETRTLIAQLPPPAIDHEQLRHQQEEMRQLRESIAEH
KPHIDKLLKIGPQLKELNPEEGKMVEEKYQNAENMYAQIKEEVRQRALALDEAVSQSAQI
TEFHDKIEPMLETLENLSSRLRMPPLIPAEVDKIRECISENKSATVELEKLQPSFEALKH
RGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDM
AALLTTIKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIF
ACGETEKPEVRKSIDEMNNAWENLNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTV
IKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDII
REPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPIS
GDPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLETMNQCW
ESVLQKTEEREQQLQSTLQQAQGFHSEIEDFLLELTRMESQLSASKPTGGLPETAREQLD
THMELYSQLKAKEETYNQLLDKGRLMLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEER
KSKLEEALNLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVN
AHRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRA
KQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIR
TGRALKEKTLLSEDTQKLDNFLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQAL
VDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSR
DDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEEFRDTVHMLLEWLSEAEQTLR
FRGALPDDTEALQTLIDTHKEFMKKVEEKRVDVNSAVAMGEILAVCHPDCITTIKHWITI
IRARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNID
RVKALIAEHQTFMEEMTRKQPDVDRVTKTYKRKNIEPTHAPFIEKSRSGGRKSLSQPTPP
PMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKK
YMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGD
GYIDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLG
NQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGA
SQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKVIPSSGSK
LKRPTPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRR
GSDASDFDLLETQSACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences F6Z3Y5
ENSCJAP00000042893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]