SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042923 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042923
Domain Number 1 Region: 484-805
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.75e-109
Family PDEase 0.000000000012
Further Details:      
 
Domain Number 2 Region: 95-289
Classification Level Classification E-value
Superfamily GAF domain-like 1.57e-44
Family GAF domain 0.00008
Further Details:      
 
Domain Number 3 Region: 275-479
Classification Level Classification E-value
Superfamily GAF domain-like 1.72e-37
Family GAF domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042923   Gene: ENSCJAG00000003176   Transcript: ENSCJAT00000054010
Sequence length 823
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:74388153:74518067:1 gene:ENSCJAG00000003176 transcript:ENSCJAT00000054010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRP
IVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKI
FLHIHGLISADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGH
VAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNG
GTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILK
KIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDALTREHDANKINYMYA
QYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVN
KMEENTGKVKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASA
AEEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKH
EVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALS
HDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTT
LKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKDLFLAMLMTACDLSAITKPW
PIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEAL
THVSEDCFPLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN
Download sequence
Identical sequences F6WR11
XP_008991014.1.60252 XP_010338648.1.74449 ENSCJAP00000042923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]