SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042930 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000042930
Domain Number - Region: 251-293
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0353
Family Frizzled cysteine-rich domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042930   Gene: ENSCJAG00000004151   Transcript: ENSCJAT00000053657
Sequence length 556
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:121190576:121318326:-1 gene:ENSCJAG00000004151 transcript:ENSCJAT00000053657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFGLPALLCTLAVLSAALLAAELKSKSCSEVRRLYMSKGFNKNDAPLHEINGDHLKIC
PQGSTCCSEEMEEKYSLQSKEDFKSVVSEQCDHLQAVFASRYKKFDEFFKELLENAEKSL
NDMFVKTYGHLYMQNSELFKDLFVELKRYYVVGNVNLEEMLNDFWARLLERMFRLVNSQY
HFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVAGDVVSKVSVVNP
TAQCTHALLKMIYCSHCQGLVTVKPCYNYCSNIMRGCLANQGDLDFEWNNFIDAMLMVAE
RLEGPFNIESVMDPIDVKISDAIMNMQDNSVQVSQKVFQGCGPPKPLPAGRVSRSISESA
FSARFRPHHPEERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNSNE
DDCWNGKGKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMALRVMTSKMKNAYN
GNDVDFFDISDESSGEGSGSGCEYQQCPSEFDYNATDHSGKSANEKADSAGVRPGTQAYL
LTVFCILFLVMQREWR
Download sequence
Identical sequences F6W6Z1
ENSCJAP00000042930 ENSCJAP00000007603 XP_002763327.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]